You have found an item located in the Kentuckiana Digital Library.
Hartford herald (Hartford, Ky.): May 3, 1911
Hartford herald (Hartford, Ky.): May 3, 1911 Hartford herald (Hartford, Ky.) 300dpi TIFF G4 page images Jno. P. Barrett & Co. Hartford, KY 1911 haf1911050301_sn84037890 These pages may be freely searched and displayed. Permission must be received for subsequent distribution in print or electronically. Hartford herald (Hartford, Ky.): May 3, 1911 Hartford herald (Hartford, Ky.) Jno. P. Barrett & Co. Hartford, KY 1911 $IMLS This electronic text file was created by Optical Character Recognitio n (OCR). No corrections have been made to the OCR-ed text and no editing has be en done to the content of the original document. Encoding has been done through an automated process using the recommendations for Level 1 of the TEI in Librar ies Guidelines. Digital page images are linked to the text file. -- w wtpi ,, y p Pfimmlmy! f tt iJPJH nw ijaW J "wy esssrcs MHnx3DmrvW!Li'""J! "!i? THE HARTFORD HERALD. Subscription $1 Per Tear, in Advance. "I feme, lit Btrali of Hoiij ffU, Ih Sewi of ill Ipltw laahriBg at 1 BmI;." All Kinds Job Printing Neatly Executed. 37th "SEAR. by the State; a HARTFORD, KT., WEDNESDAY, MAT 3, 1911. corrupt practices act, limiting the expenditures of candidates; a revision of the tax laws of the State to lessen the bur better roaas, den of taxation; better schools and laws that will prevent crimes and make mobs Impossible. m NO. 18. EDUCATORS M In E NLAR6ED HOUSE IS NOW REALITY ' Increased from 391 to 433 Members. THE SIZE . ' INVESTIGATION INTO THE IilVERMORE MOB Council to grant license to the plaintiffs In the sum of $1,000 a year, which was the statute provision prior to the enactment of the While ordinance declared Invalid. formal notice of an appeal was made, it Is understood that license will bo granted at tho meeting Monand that Bowling day evening, Green will no longer be dry territory. m S y GHANGES State Laws Governing Schools. COMMITTEE . JDE IDENTICAL With That Provided for in Crumpacker Bill of Former Session. CALEB POWERS WAS IGNORED April 29. A bill Washington, for the enlargement of nrovidlnc the National House of Representatives from 391 to 433 members and the apportionment of thoBe members to the different States on the basis of the population shown by the recent Federal census, passed the House last night after vain efforts of members of both political parties to amend It In Important i K M? Frankfort, Ky., May 1. Many changes In the school laws are rec ommended by the Legislative Com mittee of the Kentucky Educational Association. Secretary T. W. Vinson reports suggests the that the committee abolishment of the State Board of and the present State Education Board of Examiners and that a State Board of Education be substituted, WILL BE ARRAIGNED consisting of peven 'members, comparticulars. prising the State Superintendent of OHIO COUNTY FAIR Y Public Instruction, the Attorney The proposed size of the Houau is AT L08JGELES General, the Commissioner of Agwith that provided for In identical AGAIN TO THE FRONT riculture and four professional men the Crumpacker bill, passed by the Trial of Alleged to be appointed by the State Superthe last session of ConPreparing for House at intendent of Public Instruction: gress, but not acted upon by the Prettiest Grounds in the State-Ex- hibit Dynamiters Contentions bill, passed that the County Board of Education The Houston Senate. This Year Pracshall have the power to provide for leaves to the Legislatures of of Defense. supervisors for rural schools; that the power to rethe different States tically Assured. the Legislature shall pass a law to arrange the congressional districts Los Angeles, Cal., April 30. At- enable the counties to vote upon States on the new In their respective torneys for both sides in the dyna the proposition of bonding itself for Strong pressure Is being brought population basis of one member for school- equipping miting case completed arrangements building and Inhabitants. officials and stockto bear upon tho each 211,877 of y for an early arraignment of houses: that the law be changed to The two Important amendments holders of tho Ohio County Fair Co. y John and James McNamara and Or-tl- o prevent tho establishment of Inde and defeated after to have another exhibit this fall. No FRED'K WEYERHAEUSER, "RICHER THAN ROCKEFELLER." proposed redls-rinfiThe appearance pendent graded schools except in E. McManlgal. long debato were to put the was held last year because tho fair prisoners in court will not be citlos of tho first six classos, except hands of the managers claimed that the prospect of the nower In the is currently believed that Frederick Weyerhaeuser of St. Paul, "tho Leg, when they shall be votod nnd levied deferred .later than next Wedneswas poor and tho rather losing ex Governors of States when the who usually Is lumber king," is richer thun John D. Itocla-fellerday. for an amount equal In tax to the islatures had failed to act, and to perience of recent years did not Justhe wealthiest man In the world. Mr. Weyerhaeuser, who called Job Harrlman, attorney for the maximum amount which Is levied year, probnbly has no adequnte Idea as to seventy-eightHouse in the future to a tify them in making tho attempt. Is In his limit the y that by tho County Board of Education: alleged dynamiters, said membership of 430 or 433. leaving They assort that tho last exhibit nor tho extent of his own wealth. His property consists largely of Immense areas of tlmberlands, the value of which it Is difficult to compute. He the contentions of the defense will that an efficient compulsory attendreapportionments to the Sec- the one before it wero hardly profitfuture owns moro timber than nny other man on eitrth, it Is said. No monarch ance lnw be enacted: that the power be based on those grounds: retary of the Department of Com- able, taking Into consideration tho has such vast holdings of earth surface. Timber emperor is a fitter tltlo, First, that tho dynamite made by to locate coitntv high schools shall expense incident to Labor. worry, risk and merce and Neidersaul-helmfor him than lumber king. Mr. Weyerhncusor is a native of the factory from which the dyna- be vested In a Board of Education: Both of these amendments wero holding a good fair. Germany. He came to this country nearly sixty years ago and championed by the Remite tlmt Is alleged to have caused that tho minimum number of pupils prospects this year, however, vigorously The grew up with It. was required for eafh subdlstrlct shall tho explosion was purchased, publicans and with some Democratic seem better, and if the merchants Sherley, of Kentucky, and business men of Hartford will tested In tho Government Bureau of be chanced from 40 to 30 pupils: support. Mr. "Crumpackor take an Interest In the affair and Mines and would not set tire to gas. that vacancies In the office of su'i- the first offered Second that dynamite will not set dlstrlct trustee shnll he filled by th? as It was known, to glvo the encouragement which tho SOCIALISTS TO AID amendment," BOTH SISTER AND WIFE Are to Inks and oils, and an explos County Board of Education: that restrict the size ot the House to 430 fair officials think they should have, ion of dynamite of the kind said to tho subdlstrlct trustees shall ho In the future, and later Mr. Crum- another exhibit this fall seems asOF BANKER ARE SUED DEFENSE viva voce: thnt colore! have been used would not have been elected packer submitted It again as a part sured. It would certainly be of big to recommit the benefit to tho town and county and followed by sheets of flame, but. on schools within the boundary of of a formal motion bill to the Committee on Census to every business man would get his Full Strength of Party to Assist By Assignee of Two States Bank the contrary, would extinguish white graded schools he under the Jurisdiction of the County Board of flame. have the amendment put into It. On share of the money set afloat. A subject to the provisThird, a gns explosion, on tho Education, Seeks to Recover a record vote on this motion the fair ought to bo mutually profitable. in Defending Alleged hand, would set fire to Inks ions of the county school district down, 178 to 99. other Democrats voted it There Is no one to dispute that $14,000. nnd oils, nnd would bo followed by law; that the County SuperintendPowers Fails to Draw Fire. Dynamiters. tho Ohio County Fair grounds here Bhpets of fame. Powers, of at Hartford are the prettiest In the ent of Schools be required to give a Representative Caleb rr. J. A. Holmes, director of tho bond to the State for an amount not Eleventh Kentucky district, fail- State. Situated on the hanks or April 29. As Ky., Hawesvllle, the full April 30. The Boston, mon-e- v ed to draw the fire of the Kentucky Rough River opposite Hartford and strength of the Socialist party of tho result of tho failure of the Two TTnlted States Bureau of Mines, will exceeding twice the nmount of ho one of the chief witnesses called that he shall receive from the beCongressmen when he barely dutsldo the city limits, with Democratic America was offered for the defense States bank at Stevensport and . tho j o.. . onerea amenaniem - iu " .annnnr. abundant shade that covers the of John J. and J. B. McNamara, who cause of the Irregular transactions to uphold the contention thnt cas S'a'e In anv Installment: that Suby John fill rot an infernal machine caused minimum salary for the County bill aimed at the present amphitheater yet gives a tine and tlonment are charged with murder In connec alleged to have been mado gerrymander of the State. Powers full view of the race track, which Is tion with tho explosion of the Los S. Adair, tho Hardlnsburg Bank and the Times Building explosion, ac- perintendents shall be $1,000 and tho mrxlmum $2,000. and that he first wanted to provldo that congres- said to be the fastest In tho country Angeles Times building, by the Na Trust Company, assignee of tho Two cording to Harrimnn. sprii dovote nil of his time to his sional districts should not differ by outside tho big Easrn courses, our tional Executive Committee of the States bank, has filed suit against WILL WEAR COSTLIEST professional duties: that there shall 20,000 of population. He fair grounds apparently hold every more than Miss Dudo Adair, sister of tho bank party, now in session here. ROBE IN THE WORLD he school revenue Inspectors, whoso ono against his wife, made a speech In support of the advantage that could possibly be deA telecram was sent to President er, for $3,300, duties shall ho similar to tho Stat" amendment, and It was voted down sired. Tho race track Is on a beau- F. Ryan, of the Iron Workers' Un- Mary C. Adair, for $3,800, and one New York, April 30. Princess teach Ty 107 to CC. He then offered tiful table land and every step a ion, reading ns follows: Happy Hollow Tobacco Kawananakoa of Hawaii, who be- Inspector and Evamlrer; that against the ers 'ti crnntv high schools shall hold designed to prevent a horse takes can bo seen from both amendments The National Executive Commit company, of Hawesvlllo, for $7,000. fore her marrlago was Miss Abigail pprtlflcfitos of nnnllficatlons ns fol adjacent and difference of more than 60.000 or the amphitheater .The allegation In the cases Is that Campbell, tee oX the Soclollst party offers tho daughter of a wealthy Stnte certifi 75,000 population, both of which ground, while tho spectators remain entire power of its 4,000 organiza- tho monev was loaned by John S. Amerlcnn sugar plante", is in New lows: Rtnte dlnlomns, diplomas, life cates. Stato unlversltv voted down. Following their In tho shade. The grounds are Ideal tions and its press, consisting of ten Adair without the authority of tho were cordlplomps from the Department of way, right York on her wav to attend tho policy of Ignoring tbo Eleventh Ken- In almost every conceivable dallies, over 100 weeklies and ten directors and that ho had no onation in London. Education of the State, university district member, his Demo- and tho conveniences are unsurpass- monthlies, In all languages, to bo to mako.the loans. It Is also claimtucky Ono of tho robes which the Prin or llfo dlplomps granted bv tho to pay ed, while n new, railroad enhances declined booVs of the cratic colleagues coronation is used In tho defense of the McNama-ra- s, ed that" although Sae Normnl Schools; thnt the work to the Powers speech. the prospect. notes, cess will wenr at tho anv attention and any other help within our bnrk have a record of the o cape of bird's feathers, one of tho of tho Stato reading circle shall be r.i,irtr,nn Houston, of Tennessee, It seems a pity that all theso re power." that the notes themselves have eith most costly garments In world. -- pnsfprred to nnd com'uetod bv the started to reply to Powers, but was sources for a county fair should go was also nd- - er been taken from tho bank or It Is made from tho real feathers of A communication resumed unemployed, and wo think we voice State Board of Education: that nil requested not to do so, and dressed to the locals of the Social else have been lost. species of island bird now extinct. plans for wrecking schoolhousFs In the a public In sin the sentiments of tho Miss Adair, the defendant Ills seat. ist party condemning the arrest of Each bird had onlv ono of tho must bo improved by tho State cerely hoping that tho Ohio County tho mon as "suggesting a deliberate first suit, Is the' postmistress of variety of feather used in making Beard of Education. McDERMOTT ANNOUNCES FOR Fair will again come to tho front plot," claiming tho prosecution of Hawesvllle and tho Happy Hollow tho care. al GOVERNOR this, year with all Its The program for fhs fortieth e vigor LIEUTENANT concern that tho men was "Inspired by tho Na- Tobacco company Is a session of the Kentucky EduAdair, who and success. Coming to Hartford. tional Manufacturers' Association," was fathered by John S. decational Association at Owensboro. Tho Formal announcement that he On next Friday evening, Mav B. and that tho whole affair was "a is the president of tho concern. wore June 27 to 29, has been completed. Democratic nomination for CLAIMANTS ORGANIZE TO sires tho eight o'clock, In tho court house nt Every educator of prominence in dastardly conspiracy on tho part of loans amounting to S7.000 FIGHT FOR BIG ESTATE Lieutenant Governor was made last organized capital In this country to made on six different notes and two Hartford. J. W. Porter, D. D., of 'Kontuckv is on tho prortrnm. nnd McDermott, ono wore secured by $6,000 Lexington, Ky., ono of tho leading week by Edward D. organized labor by crime and of the many scholars from other States Lexington, Ky., April 28. Sixty crush best known members of the worth of tho capjtal stock of tho orators of tho South, will dollver of the violence." have been Invited to nttnnd. had been known claimants of the Robb estate of Louisville bar. It his famous lecture: "Our Wives, The. communication calls upon tho company. 0, Betterment of the rurnl school is desome time that Mr, Dermott was Pennsylvania, Bald to bo worth for locals' to raise money for tho and Sweethearts." The the Bubject to bo discussed. Mothers y advisability of enformed a permanent considering tho fense ot tho accused and for the HIGH LICENSE ORDINANCE lecture Is one of high gra'do, witty, organization hero, C. E. Smith, of carrying on of an aggressive cam-naltering tho race. You KNOCKED OUT BY COURT entertaining and elevatlngr announce- Winchester,, wbb chosen chairman Mitchell Will' Recover. One featuro of his for Socialism In California can't afford to miss It! Ho comes In and W. N. Robb, of Winchester, was Information received In Hartford hls advocacy of changes Ky., April 29. Bowling Greon, ment is Los Angeles. under tho auspices of the Baraca secretary-treasurer. condiForm and particularly In of the Judge James McKenzle Moss, In Bible Class of tho Baptist Church. from Llvermore Is that the young the procedure in the Courts result chosen Kentucky ho declares will er Judge Hazelrlgg, of the morning, handed A small admission fee of 25 cents tion of Clarence Mitchell, tho Circuit Court, this Ptate, which Making Himself Felt. n. speedier white man who was shot and se Court of Appeals, was retained In less expensive and Hon. Denny P. Smith, of Trigg down his decision In the mandamus will bo charged to defray expenses. riously wounded by William Potglv- - to flght It was also the case. This subject has been county, la fast coming to the front cases of Montgomery & Williamson Ten cents for children under 12 decided to send a committee to ter, the negro who was sh.ot to death en much study oy Mr. ns a Democratic candidate for At and John Gorln against tho Mayor years. Go and take somebody witn the by a mob, has changed for tho betpast few years, and he has Pennsylvania to Investigate In the was not thought and City Council to compel them to youl which he claims. from several torney eGneral. He Claimants ter, and Indications are that ho will i Ions advocated a change be- - grant license to Bell liquors within to be' much In the race when he In his meeting. He had fever All sizes, from recover. will bo of benefit to both States attended For Sale, Farms believes ran. but It la' now seen that 'ha la tho city of Bowling Green, and also after-th- o shoot attorneys and litigants. He also ordlnanco providing G to 300 acres. We can pleaso you wounds several days will be more to declare the Leave your Laundry at my Grocery. very much Jn It, and primary law, Etate-wld- o ing, and did not rest well for a few buy land. $5,600 Invalid. If you want to advocates a Guaranteed. In It when the primary election for a license of I A. C. YEISER & CO., days, but Is reported to bo out ot to permit men of modest means to Domestic tlfiiea. Work Judge Mobs upheld, the plaintiffs MayMd Me passes Into history, delivery. danger. Hartford, Ky. for an office, the Called for and prompt seek! nomination . In all points, and directed the City "FhoM-lW- . Wert Grocery. senger. . TtXiVK)nmS' expenses of such primary to be born uS TO-DAto-da- y. to-dato-dane Judge T. F. Blrkhead, who had been holding a two weeks term of Circuit Court at Hartford, returned homo Friday night. As usual tho court disposed of a large amount of business, and the docket was cleared of a great many old cases. Judge Birkhead will have had one week Intervening before ho opens court at Calhoun for 12 days on next Monday, May 8. Possibly one of tho most Important matters that will be dealt with by Judge Blrkhead Is tho lynching of William Pottor, a negro, by an angry mob of citizens at Llvermore a short time ago. The court will Instruct the grand jury in this mat- tor, and will urge upon them to return Indictments against those who participated in the mob. If they can secure enough evidence to do so. TAKE SPECIAL CAR FOR BENEFIT OF .SICK DOG THE LEGISLATIVE Los Angeles, Col., April 29. Rushing from San Diego to New York City on a special car, Mr. and Mrs. M. Vanbeason, of the latter place, calmly gave as their reason, when their car stopped here that they are making the hurry-u- p trip because their Cantonese dog has a sore eye, which they fear will cause blindness. The dog is a valuable animal, and recently took cold in Its eyes while being exhibited at a dog show. Fearing that It would go blind, its owners started In a special car from coast to coast to receive the advantages of expert service In New York City. to-da- y, Of School Organization Sug gests New Board and Reforms. SOME CHANGES ABE PROPOSED IT h to-da- 1W .- .. to te . nn-nu- old-tim- nc-te- s $50,-000,00- to-da- cn lltl-catlo- """" to-da- " r -- wi-rtryr - , wl&fQp1. 'TWEgif ft p leaders. FORTUNE SOLD FOB McNamara Says Ho is Innocent. 46 April 28. Los Angeles, Cal Breckenridge SUNDAY-SCHOOLT John J. McNamara, secretary-treasurIN S 19 Bullitt .. '. of tho International Association Los Angeles Man Pays $50,000 Butler ...27 Of Bridge and Structural. Iron Work12 Caldwell For Volume Once In 44 Calloway Charged Wholesale ers, gavo the first authorized stateShow Gain of 259 in as to his arrest to the Asso55 ment Campbell Hoe Library. BOURBON POULTRY Dynamiting. ciated Press 40 Clay Three Years. CURE 985 The statement follo.ws: 20 Carlisle New York, April 28. The first . JSS.aSSSSSJ 1,982 "To the brotherhood of organized 24 Carroll down the throat of m irraMKnt chicken, destroys the worm THERE ARE3J45 SCHOOLS Carter 2,391 BIG LEGAL BATTLE IN SIGHT labor In California and tho United book ever printed from movable 32 ana saves the chick's lite. types last night brought the highA few drop In tbe drtoklcj 48 2,493 Casey States:' water caret and any book. "In this second attempt to crush est price ever paid for 2,891 30 Christian . . '. Begun by Labor Lead- and discredit the cause we represent, The prize was the Gutenberg Bible, PREVENTS DISEASE Secretary of Clark In the State 23 2,404 Plans For tbe treatment ol While Diarrhoea In chick tho purchaser, Henry E. Hunting1 realize fully the desperation of tho 905 10 Clinton and Blackhead and other diseases In turkey ers to Defend the AcState Association Makes enemies of labor arrayed against us, ton, of Los Angeles, and the price 2,916 Crittenden ..42 BOUBBOH POULTRY CURE HAS MO EQUAL but I am of good heart, for it will $60,000. 12 719 Cumberland cused Officials. Report. The purchase was made at the opfall. 39 4,627 Daviess HI One 30c bottle makea 12 gallon of aiedlclntt li"That I am Innocent of any in- ening session at the sale of the 1,136 PLACED IN SEPARATE CELLS SolU by X. Wilbur Mltchell.V X M 17 Edmonson OHIO COUNTY'S DIG SHOWING fraction of the law In word or act, brary of the late Robert Hoe, the 24 1,840 Beaver Dam, Ky. Estill needs no emphasis from me, for largest public auction sale of books 16 1,007 Elliott April 28. Angeles, Cal Los The Rev. George A. Joplln, soc- es6,678 John J. McNamara, secretary of the truth Is mighty and will prevail ever attempted. Experts have 50 retary of the Kentucky Sunday Fayette timated the collection to be worth 1,866 International Bride and Structural right speedily, and for it I shall con 33 has completed Fleming School Association, more than a million dollars, and SOLD BT 30 1.782 Irion Workers' Association; his tentedly wait. compilation of the census of the Floyd the wealthy amateurs and dealers from "I send to all brothers and friends 25 2,495 brother, James B. McNamara, and Franklin white Sunday Schools of Kentucky, 17 1,979 Ortie E. McManlgal, the alleged of union labor, world over, my earn- Europe had come to vie with the CARSON a work that has been In progress Fulton American collectors In the bidding. 17 1,526 dynamite Gallatin conspirators accused of est and affectionate greetings, with since January 1. Such a census Is The highest prjee previously paid 26 1,460 blowing up the Times newspaper assurance that there is no villlany or Garrard $20,-00- 0, taken every three years and a report Grant 29 1,992 plant last October, killing twenty-on- e conspiracy possible of which wo are for the Gutenberg Bible was of the data obtained Is made to the at which Bernard Quaritch afraid. 2,909 50 Graves men, are In the Los Angeles Jail International Sunday School Asso- Grayson "I am also confident that it is not purchased it In England fourteen 54 3,916 LIBERTY SPEClALl CO. y In separate steel cells, surciation, the headquarters of which asking too much of the public to sus year ago. At a private sale he dis26 Green 1,854 rounded by extra guards. All three . are In Chicago. The work Is Inter- Greenup pend judgment in these matters un- posed of it shortly afterward to Mr. 58 3,062 men are charged with murder. HAR.TFORD J'Ott MEN. denominational, and, In this State, til opportunity for full and fair de- Hoe at a profit of $2,500, and it 15 1,219 Hancock embraces the white Sunday Schools Their arrival Wednesday after a fense has been afforded." has remained In the Hoe collection 52 3,498 Hardin of all Protestant churches. ever since. The copy waB printed sensational Journey in Irons from J. J. McNAMARA. 39 Harlan 2.790 The census shows that there are Indianapolis and Chicago, signalizes some time between 1450 and 1455. 35 3,514 Sunday Schools, Harrison In Kentucky 3,7-1beginning of what is expected NOTABLES REFUSED TO Bidding for the treasured book 28 2,029 the Hart NAME TRIPLET BABIES was spirited, with Bernard Quaritch, a gain of 259 as compared with to be a desperate legal struggle. 42 Henderson 4,523 three years ago. The enroll- Hlckmnn however, no definite ar son of the forme" owner, partici24 1,940 Thus far, Henderson, Ky.,- - April 29. "De pating until the bids passed the$21,- ment this year Is 308,174, a gain of rangements have been made to iniHopkins 39 2,627 clined with thanks" is the substance 000 mark. with 161,000 Henry 47.1G4 as compared defense. From there It Jumped 37 2,934 tiate their the enrollment In 1908. counsel for the of letters received by Mr. and Mrs. by thousands at a clip to $45,000. O. N. Hilton, If you need building ma Jackson 1,757 ...30 George county has now 1S5 V. Duncan, of Corydon, At $49,000, P. A. B. Widoner, of JeiTefBou Jefferson 185 34,628 Western Federation of Miners, who this county, from former terial, call on us. We have Sunday Schools, with an enrollment President Philadelphia, who had been tho Johnson 20 1,318 came hero presumably to Join coun- Theodore .Roosevelt, Rough and Dressed Lumber, of 34,628. Three years ago there President Taft, most determined of the runners-up- , to sel for the defense, started y Kenton 56 6,052 were 173 schools, with an enroll Mrs. Russell Sage and Miss Helen dropped out of the race, and the ev- Doors, Sash, Moldings, MoorKnott 12 958 establish headquarters and a work- Gould, all of whom had been Invit- en ment of 30.390. $50,000 was bid by Mr. Hunting- ing, Ceiling, Finish, Siding, I Knox 17 1,720 ing force to launch the battle, but ed to name triplets born to the DunNext to Jefferson, our own Ohio ton. stopped all preparations when he reLathes, Shingles, Columhs, Larue 23 1,326 county has the banner enrollment cans March 8 last. The total sales of the day and Laurel Rubber Paper and Metal i 32 2,312 ceived a telegram from President "Well, well," said the mother, night sessions wero and number of schools of any coun$134,866 for Lawrence 60 3,435 Ryan, of the Iron Workers' Associa- holding the letters from the noca-blRoofing. Ridgeroll Cresting V' ty In the State. The stupendous 379 numbers. Leo 23 1,546 tion, saying that all matters perIn her lap. number of 118 schools with a total Leslie "I thought they Next to the Gutenberg Bible, the and Guttering, House and 7 569 taining to the defense of the Inter- had forgotten our request. of 8,193 attendants, go to our credI'm Book of St. Albans, compiled by Roof Paints, Lime, Paten Letcher li) 6S0 national secretary and his reputed glad George it, although in the Courier-Journal- 's and I didn't wait to Berners and published by Cax-to- n Plaster, Cement, Common and confederates were in the hands of Lewis 64 4,230 summing up of this matter, wa get name tho babies now." To n neighIn 1486, brought the highest Lincoln Fire Brick, Screen Doors and 32 2,347 Indianapolis lawyers. no especial mention. bor Mrs. Duncan bought by Livingston "There is almost nn Infinity of and her husband confided that she price $12,000 also 24 1,468 grown tlrei of Mr. Huntington. It Is tho third Wire. Some of the mountain counties had Logan 55 3,825 things suffering to be done at once," tho apparent delay and had named "have shown decided progress In Sunbook eyer set up In typo by English Lyon said Attorney Hilton. "But there 19 1,210 day School work. Letcher county, the children themselves. They will printers. 51 5,208 have been no preparations and there bo called Ralph, Ruth and Ruby. which three years ago had five Sun- McCracken The tenth book of tho history of McLean 30 2,037 1b no money in sight except the fund day Schools, with an enrollment of West End Union St. pledged by Confederate Veteran Reunion, Little the Ethiopians, by Heliodorus, printMadison 38 5,117 aggregating $250,000 233, now has ten schools, with an ed In Basle, Switzerland, by Ican-nel- n Moyer, of the Western Magoffin Rock, Ark., May 15-111 1011. 488 President enrollment of 650, and Leo county Marlon Oporlnum In 1552 and bound For the above occasion the Illi1,231 Federation of Miners." is has advanced from thirteen schools, alleged conspirators arrived nois Central Railroad Company of- by Grolier, went to Walter M. Hill, The Marshall 29 1,983 with an enrollment of 550, to twenty-thof Chicago, for $5,000. 7 408 at the Jail in automobiles after run fers rato of $9.10 for the round trip ree schools, with nn enroll Martin A history of Italy, by Francesco ning the gauntlet of two crushing from Beaver Dam, Ky tickets on Mason 44 2,908 ment of 1,546. bound by Nicholas crowds, which In their eagerness to sale May 13, 14 and 15, 1911, only. Gulcciardinl, Meade 22 1,657 Hreathltt county has not done so got a glimpse of the prisoners, over- Final return limit to reach original Eve In 1561, with a Mercer 25 3,100 woll in Sunday Schools as it has in portrait In mosaic, of morocco and 10 599 bore the efforts of more than a score starting point not later than Mny Sunday Metcalfe feuds. It has twenty-si- x vellum, of Henry III., was bought de23, 1911, unless an extension of 13 902 of detectives and deputy sheriffs Schools, the same number that It Monroe A. for $2,600 by Mr. Huntington, who Montgomery limit Is obtained. 13 1,080 tailed to hold them back. had In 1908, but the enrollment has was tho heaviest buyer of the day. Morgan By deposit of return portion of 'The men were taken from the 12 1,057 fallen from 1,851 to 1,470. 40 3,010 California Limited train In Pasade- ticket by original purchaser with J. Silent For Once. W. H. & J. F. GILLESPIE, Fayette county's Sunday School Muhlenberg trip to the E. Hannegan, Special Agent, 115 25 1,851 na and, on the nlne-mll- o "Did your wife Jump on you when have increased from forty-si- x to Nelson PROPRIETORS. speed Center street, Little Rock, nnd pay- you got homo late last night?" 29 2,109 county Jail by automobile, fifty, and Its enrollment from 5,981 Nichols During tho ment of fee of fifty cents, extension 8,103 laws were disregarded. "No; for once I was In luck. The to 6,678. Campbell's schools In- Ohio .. 25 2,091 trip from Dodge City, Kan., where of return limit may be obtained to people In tho flat next door were creased from fifty to fifty-siand Oldham 38 2,134 John J. McNamara boarded tne train reach original starting point not la- having a spat and my wlfo was busy its enrollment from 5,156 to 7,692. Owen Owsley 10 535 bearing his brother and McManlgal, ter than June 14, 1911., This faro listening." McCracken shows an Increase In Pendleton 25 accommoda2,234 the three men were kept In sepa- applies for first-clato fifty-onschools from forty-tw- o Perry John know tions, and tickets sold at above rate Subscribe for Tho Herald. SI a year. 11 869 rate compartments. nnu us enrollment irom i,'oi i to Pike 40 2,639 that his brother was under arrest, will be accepted In chair cars, also 8 413 because he caught a glimpse of him In parlor and sleeping cars, upon county, according to the Powell Daviess Pulaski 92 6,522 as he entered the railroad station In payment of regular tariff charged census report, decreased In the numA 15 1,175 the Kansas town, but John was ig- for parlor or sleeping car rates. ber of schoolti and in enrollment. Robertson 30 1,711 norant of the situation of his al For further Information, call on Three yoars ago there were forty Rockcastle 15 893 leged confederates. or telephone, Sunday Schools in the county, with Rowan James McNamara and McManlgal 28 1,474 J. E. WILLIAMS. Agt., an enrollment of 5,335, whllo the Russell will save the dyspeptic from many Scott days of misery, and enable him to eat 24 18t2 2,185 were taken from the train at the Beaver Dam, Ky. new census shows only thirty-nin- e whatever he wishes. They prevent Shelby 40 2,891 main station in Pasadena nnd husHenschools with 4,627 enrolled. Sick headache results from a dis- SICK 26 2,988 tled into a motor car, while John HE$)ACHE, county lost one school dur- Simpson derson 14 1,053 remained in his compartment until ordered condition of the stomach, cause the food to assimilate and nour ing the three years, but increased Us Spencer and can be cured by the use of Ish the body, give keen appetite. 25 1,525 Raymond, a suburban station of attendance. In 1908 there were Taylor Stomach and Liver Pasadena, was reached, where a sec- Chamberlain's Todd 35 2,932 forty-thre- e schools, with 4,267 enTry It. For sale by all DEVELOP FLESH Tablets. 20 1,478 ond automobile was In waiting. We promptly Obtain U. B. nnd Foreign rolled, whilo tho now census shows Trigg and solid muscle, Elegantly sugar dealers. m Conspicuous in tho crowd there -- a. coated. 24 2,484 forty-tw- o schools, with 4,523 schol- Trimble Take No Substitute. Union 30 2,757 was Mrs. D. & Ingersoll, the wo- A COMMON EXPERIENCE ars. 50 3,052 man who Is exppcted to play a promAND THIS WAS LOVE The Sunday Schools of tho State Warren Mm. 55 1,959 inent part In the prosecution. are much better organized than they Washington HABDAVIOK, OWENSBORO Wayne 42 A young man and a young woman 2,087 Ingersoll Is the San Francisco boardSana model, sketch or photo of Invention lor i were three years ago, according to toe.report on patentability. For free book, i ing house keeper in whose place the lean over the front gate. They are O Fine Watch and Jewelry Re- - 52 3,157 Secretary Joplin, and are doing Webster man known as J, B. Bryce stayed lovers. It is moonlight. Whitley pairing. to" 60 sEOKAUt-MARK- S 3,634 Ho is O much bettor work. During that peWoodford 29 2,507 prior to tho destruction of tho Times loth to leave, as the parting Is tho riod several thousand teachers have Expert and Artistic Monogram 12 793 building. last. He is about to go away. She M completed a special training course Wolfe James McNamara, according to Is reluctant to see him depart. They and Plain Engraving. by tho State Sunday prepared 2 Do Ghosts llniint Swamps? William J. Burns and tho other de Bwlng on tho gate. School Committee, and there has pS Eye's No.never. It's foolish to fear fan- tectives, is held as Bryce, the man and Lenses Ground. Tested, "I shall never forget you," he been a great Increaso in the number cied evil, when there are real and who Is alleged to have laid tho In- says, "and If death should claim me, O In our Shops. of adult Bible classes, more than deadly perils to . guard against In . 400 new ones having been organiz- swamps and marshes, bayous, and fernal machines that blew up the my last thoughts would be of you." newspaper plant, and the woman Lens- O We have a complete "I'll be true to you," she Bobs. ed since 1908. lowlands. These aro the malaria was there to Identify him. Professional Garcia. "I'll never see anybody else or love g Grinding "There has been a great Improve- germs that cause ague, chills and Plant and two In a third Seated automobile, them as long as I live!" They partment In grading the schools and In fever, weakness, aches In the bones a J. M. PORTE1, up by the side of the one ed. Graduate Opticians and can their equipment," says Mr. Joplln. and muscles and may Induce dead- drawn was ' which to transport the years later he returns. His Six Sunday Schools aro be- ly typhoid. But Electric Bitters de"Tho give perfect results. prisoners, she peered Into the sweetheart of former years has mar- K BEAVIB, DAM, KY. coming more more and real stroys and casts out these vicious face of McNamara as he climb- ried. They meet at a party. She o Don't buy Glasses from spec- - P Will practice hi profession In Ohio and ac. schools where teaching Is done. We germs from tho blood. "Three botolnlngconntley. Special attention glToatoal.' ed Into tho machine. The man has changed greatly; between the K bnslnessenlrnsted to nil care. find that 85 per cent, of tho memO tles drove all tho malaria from my was shackled to an officer, but tacle peddlers who travel W dances the recognition takes place. bers coming into tho churches come system," wrote Wm. Fretwell, of he kept his unbound hand P1ANK L. FELIX, "Lot me see," she muses, with her CO from city to city. from tho Sunday Schools. Great Lucama, N. C, "and I've had fine his ii stress has been laid in tho Sunday health over since." Use this safe, Ingersoll face. In spite of this, Mrs. fan beating a tattoo on her pretty W We have Skilled Workmen and Q declared afterward that hand; "was It vou or your brother Schools on a definite confession of sure remedy only. 50c at James HAKTZOBJ), XT, ho was Bryco. who was my old sweetheart?" religion and preparation for. Chris- H. Williams. Will practice his profession la the very Finest and Best m and Mi The nine-mil- e Journey to the Jail slnlng counties and In the Court OhioAppeal. "Really, I don't know," he says; Q of tian service." O Criminal practice and Collections apeelall was mado In twenty minutes and "probably my father." Machinery and Stock and are a Offlce In tht Herald batldlng Work haB begun on the building jjT County Statistics. "" McManlgal ond James B.' McNamara nim County School Enr'lmt. of tho palaco of the future Chinese were hardly out of In a position to render good 5 C.M. the prison corri, BAB.HKTT. C. . IIOIH. 2C 1,778 Parliament at Peking. The struc- dor before the automobile carrying JVdalr on fi service. lARNBTT & SMITH, I 90 4,791 tures are modeled after those of the John McNamara Allen a arrived. 18 3,803 Belgian Parliament. Tho total cost Anderson For Infants and Children. C Wo pay cash for old Gold and O Tho three prisoners were placed will bo 11,300,000. Mr. Klein, a 18 1,100 Uallard HAMIOXD, XT, in separate cells and will have no Till KM Ym Hivi Always g JKL1! Silver. lit g 2,982 German, Is the architect. "jProlaarioa in all .35 Barren opportunity to concerse with each and MietelBX oaatKa and laUk Court tt Coir OtfOriSNUAVO 'HOUVOUVH '.AG 1,390 Bath '.". .. , Bears tbe other. The made no request of the '2,473 .30 Bell .. Signature of authorities that they' be FOR FLETCHER'S 1,402 36 Boone to see attorneys, although ncri i v a mi--i . LULE ETE SAUTE i i 2,677 TJourbon ..24 J they will be allowed that rlglit when Subscribe for The Hartford Herald, i nothing but fw rwr inwrnM ana auaanwi raiiw "I THE KENTUCKY Boyd . . ? Boyle ., Bracken '34' 34 Breathitt 27 26 a Last 4,712 3,050 2,077 1,470 2,882 1,221 1,709 1,160 3,914 7,692 1,906 NOTED PRISONERS they ask forlt. Thoy ll be permitted to Bee a few union labor also-wi- MlUT'lllBinBS- -" GONFINEIN With er "" to-da- y. M L v & to-da- HATS 3,-4- Headquarters for Building Supplies. to-da- es Jo-lia- na Bean Bros., Hartford, 8, Ky. full-leng- th GILLESPIE' BROTHERS. A lis x, ..BLACKS1THING.. ss e. j,-2- 0. Andn:M. UnGUdll Work Horseshoeing Specialty TutfsPills HARTFORD Kentucky. I l.feiHH.H r - 1 Attorney at Law, bo-fo- ro Attorney at Law, r -i- CASTOR A Attorneys at Law, .- .....'. Children Cry to-d- ay ed C A S T O R A. &. tag HTEIUm m4 m fv ot.. I nn .W itaivj V" t " ttent exclamation and harsh rebuke; processes of mind and will alone, to a religion that Is polite, deferential AND make ourselves the parents of a MONEY to our BE FORMS OF to superiors, considerate child which will be perfect In mind M Ii the belt of all medicines for the cure of diseases, friends: a.rellglon that goes Into the Zf and body. disorder! and weaknesses peculiar to women. It ii the family and keeps the husband from of its kind devised by a regularly tfradu "I am aware that such a purpose CONVENIENCE being cross when dinner Is late, and only preparation an experienced and skilled specialist in eted physician MARRIAGE will be ridiculed, and that many will LEGAL the diseases of women. keeDs the wife from fretting when sneer, but if the result I hope for Is the husband tracks the newly wash It is a safe medicine In any condition of the system. convince attained, we will at least ed floor with his boots, and makes THE ONE REMEDY which contains no alcohol Exemplified in Its ourselves and our closest friends of As g Are Spurned By drugs and which and no injurious the husband mindful of the scraper theories, and of ' tho truth of our creates no craving for such stimulants. and floor mat; keeps the mother pacertain Scriptural dogmas in which Louis Couple, tient when the baby Is cross and THE ONE REMEDY so Hood that its makers I am a believer." amuses tho children as well as Inare not afraid to print its every ingredient on Ernest Roehlk said that he and IF THE PEOPLEJD BUSINESS structs them, cares for the servants each outside bottle -- wrapper and attest to the tfHO UNITEBYPUBL!G PICT Elizabeth Olk had decided to enter besides paying them promptly; a truthfulness of the same under oath. on a union without formal raar- religion that projects the honeymoon place It is sold by medicine dealers everywhere, and any dealer who hasn't it can rlace. and that this would take Values, Into the harvest moon, and makes get it. Don't take a substitute of unknown composition for this medicine of Will Live Together Right after Miss Oik's return from Ger- - By "Swapping" for known composition. No counterfeit is as good as the genuine and the druggist the happy home like the Eastern flg Like mnnv. a fnw months hence. who says something else is "just as good as Dr. Pierce's" is either mistaken How Could They Deliver tree, bearing on Its bosom at once AlongUnless State Comor is trying to deceive you for his own selfish benefit. Such a man is not to he their brother and sister, they wish the tender blossom and the glory of trusted. Ho is trilling with your most priceless possession your health-m- ay the Goods? that tho woman's name should be pels Otherwise. be your life itself. St that you gtt what you ask for. ripening fruit. We want a religion unchanged by her choice of a llfo that shall Interpose between the companion. SOME ODD CUSTOMS RECALLED ruts and gullies and rocks of the SEEKING PERFECT OFFSPRING Louis Roehlk Is 44 years old and souls highways and the sensitive Maria Olk Is 33. Ernest Roehlk Is Senator McCumber, of North Car- that are traveling over them. When St. Louis. Mo.. Anrll 29. Louis 36 and Elizabeth Olk 29. colleagues olina, In addressing his get fixed up along that line, there 3810 Olive Btrcet, arC. Roehlk, Louis Roehlk was asked for an In opposition to the reciprocity bill, we living here of tist, and MIbs Maria Oik, sister of him declared that C'tly folk'i are wan- will be some peace In explanatlpn of the attitude and everybody will not be afraid Hugo Oik, the concertmeister of the self and Miss Olk toward the mar- tonly extravagant, and produced a everybody else Is going straight to St. Louis Symphony Orchestra, sent rlauo relation and what the actual and certain picturesque Yellow Jacket. an advertisement to the newspapers meaning was of tho advertisement. slncular of queer figures to prove hell. tabulation this afternoon to notify their friends many ques"Don't ask me too He said that when the farmer EVENT OF HIGH SOCIETY and the public that they had been tions." ho exclaimed. "I am tired It. to snend a day In tho city, his (INCOKI'OHATED) THE SHEPHERDESS SPEAKS enes united without the forms of legal of answering questions, but I will of expenditures Is as follows, marriage. The announcement Is as try to tell what It means. Maria scale The society editor was perched on In terms of the products or. me follows: knd I were sitting In the park, I fnrm! chair In the back a much-glide- d "St. Louis, Mo., April 12, 1911. don't remember what park, last Cab to the hotels, six bushels of parlor, lnteniewlng the mother of a "On the 12th of August, 1910, we August 12, and we talked the mat- oats; tip to driver, 15 cabbages: tip bride whose wedding was to take were united before God and man. ter over and decided upon this un- to elevator boy, two dozen eggs; tip nlace that evening. Dignity and vast "Louis C. Roehlk. bush- elegance, lige unto that of a dowa ion. It was hard for me to make to bellboy, one and one-ha- lf "Miss Maria Oik." myself understood to her, but, when els of barley; breakfast, three ger duchess, distinguished the good be The Roehlk- - brothers are fresco she grasped my idea, she consented, fourths of a ton of hay; tip to wait woman about to annex a and portrait painters and photog- and even now it is hard for mo to er, two bushels of potatoes; lunch Plainly enough this was to be one. of raphers. The Oik sisters are vio- make myself understood to other eon, one sheep; tip to waiter, one those afTalrs of which the little S. linists. Their brother, Hugo Oik, people. and a half bushels of carrots; din E. should write: "One of the larg'POSITIONS' V fteeA-Areczri-g "She brought her studio hero af- ner, four bushels of rye; tip to wait est and most fashionable," &c. Real who has been a prominent figure in Plentiful ap- ter that, and people began to ask er-- , one bushel of onions; room, half lace, family heirlooms, court trains, symphony concerts for years, iSfiMMom ah heavy white satin were proves the arrangement Into which me questions. They asked me if we a car of turnips. tNUl orchids and Maria has entered. He shares the were married. I belong to organiza Tho Senator from North Dakota strewn through mother's monologue r . SZ?AP. . tions to which I must answer such does not Include In the reckoning of the coming nuptials as freely as Roehlk studio with them. iBOARD) studio, where Roe- questions if I am asked. We thought the price of theater tickets for the tho flowers that bloom in May. Inquiry at the would quiet all "And little Dorothea, sister of the ?2l&Zd4tWf, &17WUSK7 hlk, his brother Ernst, Miss Oik and tho advertisement more speculation evening's diversion, nor the trans -revealed a talk, but there Is portation and the supper afterward. bride, who Is to be a flower girl." her brother Hugo live, "'"' Gjrccn,i$'. These charges might easily amount mother purred, "will be dressed like strange double romance of the Bo- than ever. you what we are to toi "Now I will tell the wages of the hired man for a a Dresden shepherdess, with golden Is the traditional which hemia, trying to do. We believe there will month. of art's devotees. home be offspring of this union by sugges"Ma," a shrill youns voice plpr-The translation of the payment Not only have Louis Roehlk and tion, according to a certain doctrine for the comforts and luxuries of civ- from the stairway, "where's the for Maria Oik slenlfled their choice of the Christian church." ilization into the terms of agricul- washrag?" Pach other for life without the ben-t- it that has been paid out of the ?100,-00- 0 tural products, brings one back to of clergy or sanction of the fund, though Beveral reward payment was custhe period when State, but a similar union has been DUTCH TAKE POSSESSION CITY OF 1YIAGIG TD BE thousand dollars of that fund has tomary "In kind," and reminds us pledged by Ernst Roehlk and Miss been used to pay transportation exthat the word "pecuniary" is deOik, brother and sister of Elizabeth ISLAND rived from the Latin word that sig IN WILDERNESS penses of witnesses and officers. The OF PHILIPPINE . BUILT the principals In the first agreeJudgment recites that as the Reward nifies a flock or herd of cattle. Tho ment. have no funds in Commissioners of students at American PI.ACED IN YOUR RESI- Elizabeth Olk Is now In Germany, But Uncle Sam Will Not Protest term-bill- s century Of Kentucky, to Accommodate their hands to pay the Judgment, the colleges In the eighteenth DENCE OR PLACE OF UCS- taking a course of violin lessons. Auditor of Public Accounts Is direct were often paid, as subscriptions 1NESS, AND PUT YOURSELF She is wearing a wedding ring given Thousands of Foreigners Against Grab of Useless ed to pay It. for country newspapers are fre her by Ernst Roehlk, the latter deIN DIRECT CONTACT W'TH ' quently defrayed nowadays, In kind Land. Who Are Coming. Is there anything In all this world clared, and he exhibited a ring THE eggs or ling wood or butter and that Is or more Importance to you which he wears as her gift. corn. The actual sight of what a Food must be Washington, April 29. The mak than good digestion? Manila, April 29. Delayed ad Wedding rings are also displayed given sura of money will buy, is far must be by Louis Roehlk and Maria Olk, vices received hero via Jolo report ing of a patch of Kentucky wilder- eaten to sustain life and TO ALL STATES. hand, his on that the Dutch have taken posses more impressive to the untutored ness into a town of 10,000 people digested and converted Into blood. hers worn on the left FOR THE COMPANY'S SPECIAL mind than tho cash In hand, which whole his right. The rings represent the sion of Palraas Island, sixty miles partly accounts for the eagerness of within six months was commenced When the digestion falls, the Tab- CONTRACT TO THE FARMERS, Post-offic- e Depart body suffers. Chamberlain's two in- southeast of MIndlnao, lowered the when the only concessions which the poor and Improvident persons to ex and reliable cure CALL ON OR ADDRESS tend to make to the customary mar- United States colors and substituted change their earnings as soon as ment ordered the establishment of lets are a rationalThey increase the W. O'BANON, e. Jenkins will for Indigestion. riage uses of ordinary civilized so- the flag of Holland. possible for something of impressive the Jenkins Local Manager, bile, purify the blood, Consoli flow of ciety. It is understood here that Washappearance. be the headquarters of the Hartford, Ky. compels It," ington does not Intend to protest bulk or spectacular in strengthen the stomach, and tone up Company's operations the State "Unless They may buy something they do dated Coal digestive apparatus to a SEXTON. W. said Louis Roehlk to a reporter, against the action of the Dutch, the not really want because they seem Pike and Letcher counties, Ken- the whole healthy action. For Local Manager, while Miss Olk stood approvingly United States Government regard- to be. getting a great deal for their tucky. It will be the center of the natural and m which sale by all dealers. Beaver Dam, Ky. never go ing tho Island as valueless. Incorporated. of the company beside him,, "wo shall money. The successful auctioneer activities cerA little head native Filipino found owns and will at once develop thous through the ordinary marriage Cnn You Heat It! knows of this human frailty, and Is of rich coal lands emony. If some officer of tho law proudly wearing a cap, evidently tho The first Look here! Customer not slow to take advantage of It. ands of acres PARKER'S should undertake to prosecute us, I gift of a Dutch captain, precipitated The child with a penny io spend for theTe. BALSANI HAIR beautiflei th hall. time I used this umbrella I bought nd Cletotei waive our objec- the Issue of sovereignty of the Pal-mof Jenkins is but Though the site suppose we would luiuriant prowth. Promote! candy cares little for quality, and of you, the black dye soaked out and Never Falls to Kettoro Qrsy or wild land now, 2,000 homes Island about two years ago, and tions and satisfy the requirement. dripped all over me. a cent In preference a bit ICtrti usvlp diteisf! St hair tilling- within six to change her the State Department hurriedly con- takes seven for made there But Miss Olk Is never JlCtlllU J IA" r' lMKim Dealer Meln frlent, dot was ono to six, because his penny seemB to will ho name. She and I wish that she con sulted Us maps and records, but the further In the purchase. months and 10,000 persons will be of our new umprellas. tinue to be known simply as Maria wholo question was decided almost If any one steals dot umprelia, you No one can realize the conven- domiciled there. ' at Its inception for want of Interest. ience of money till ho thinks of Senator Watson, of West Virgin-l- a, would know him by his clothes. Olk." tn-The Washington Government has VJIR MH.n Is at the head of the company. XlUgO Stll. tttlUU UC.O ffftlfl f!or. il... w what It would mean to Morgan or unusual nature of many four years ago and became no particular desire for tho Palmas Rockefeller to have a colossal for- TJecause of the ft9H'LlHBSBBBBMMLDftBBBBBBKLv'flJfl Department acoualnted with the Roehlk broth group, although It has been deemed tune changed into oats and cab- the case, tho Post-omc- c ordinary waiting of who had then recently opened a part of the Philippine archlpalego. bages, onions and potatoes. ers, Tho wnlved the required as a prelimiThe Washington Government has their nrt studjo. Louis Roehlk had conductor who was paid a couple of three months post- of years run a wagon shop no advices regarding anv recent de in former sweet sweet potatoes instead of a nary to the establishment KE2&gSfH diamond, a atch, StWjsf jMBI in St. Louis, but had taken an art velopment, and ono offlclal stated nickel by each passenger would office and granted the request or aBlde from sentiment It Langley, of Ken-tnci- tr. Germany, and had brought in spring anrJVsummer, it's that course in have no room in his car for pas Representative mn nnnirn i rirnn rr irnrA im made no difference whose flag float sengers. liln brother from that country. that It be established at once. What an experience it health and vitality for the Campbell was named Becoming very friendly with the ed there. Oeorpo D. foLDEST MAIL would bo to carry a handful of year, Roehlks, Hugo Olk mentioned them postmaster. beanB in one's pocket to pay for the . Saved Chilli From Death. to his sisters in Gersmw ORDER HOUSE i&zra i in his letters 23c isn Smiill Amount. "After our child had suffered morning paper, or to make a purIN THE SOUTH. many. The young women came to pumpkin and receive a For atmost half a century we have Krvede x J You would not suffer ono day for years ago, and last from severe bronchial trouble for a chase with a rre dusivciy ire aoumcni nuuc. St. Louis two Address, f squashes In chance! The In- five times that amount. Then try (or our free illustrated catalogue is Nature's best and quick ..mmor thpv nnri Olk moved into vear," wrote G. T. Richardson, of few money, often roundly Sutherland's Eagle Eye Salve, Wc All Druwbts est help. Olive-strestudio, and the two Richardson's Mills, Ala., "we feared stitution of & CoB. If ) the C. consumption. It had a bad abused by moralists, deserves Its guarantee It to cure. It's painless 110X20 women began to keep house for the it had 7' m Philadelphia Ledger. and harmless. cough all the time. We tried many popularity. Krery Artlcla Guaranteed. mree uit-u- . avail, and doc "Last August." said Louis Roe- remedies without LOriSVILLE.MEN TO GET Eczcinn N&Sjjj we tor's medicine seemed as useless. 35 hlk, "Maria and I decided that SHARE OF GOEIJEL' REWARD HAVE YOUR SUITS we tried Dr. King's Now YIeldds readily to Dr. Bell's Antibe married, but not In the or- Finally would pleased to say septic Salve. You see an Improvedinary manner. We both regarded Discovery, and are Frankfort, Ky., April 2S. In tho effected a complete ment after tho first application. We the ceremony of church or State as that ono bottlechild Is again strong guarantee it. It Is clean and pleas- Circuit Court this afternoon Judge an outward, and, in our case, unnec- cure, and our -rendered Judgment for m Cammack colds, essary form. I am a Mnson, a mem- and healthy." For coughs, croup ant to use. 25c a box. in ravor or Thomas R. Grlf-fl$5,500 Louis, a hoarseness, la grlnpo, asthma, ber of Erwin Lodge of St. of Somerset, and Armstrong and most Infalli CRYING NEED OF RELIOIOX Repairing mid dyeing neat Knight Templar and a Shrlner. and sore lungs, It's the AND NOT OF MORE SECTS Harding, of Louisville, against the ble remedy that's made. Price 50c Through brothers In those organizaly done. Goebel Reward Fund Commission, bottle free. Guar TimmntlvnlinlnAd In nil ranntrlM OR MO FKE. tions I learned that tho presence of and $1.00. Trial H. Williams. Ladies work given special TR ADK-ARKS. Caveau and Copyrights m The preachers In the North and as a reward for tho arrest and conanteed by James Hend Sketch, ilodei or i'noto, for Maria Olk In the studio had been jtit hra.i'L. TBrsT itPnDTnn Ttinttltltv. are trying to get together and viction of' Henry E. Youtsey and attention. South wrxriusiTriy hark niriinii9t the subject of gossip. I resolved to Always. Send 4 rents In stamps for our two lnralnable Howard, who were con Hats cleaned and repaired. incorporate the entire Methodist or James B. hooks vn nun iu unisin miu sill end this, and so we sent tho adver- The- Judge de Mrs. Highupp. NTS U hlrh ones will pt. How to jret a part of Gov. ner, patent law ana olhrr tamable iniormatioo. Work called for and seuing creed that they should be separated, ganization Into one grand Church. victed of tho assassination to a newspaper, tlscment ftJV We believe tho churches ought to all Goebel In January 1900. marAugust 12 as the date of the never to see each other again. get together on a general plan for . Griffin sued for$10,000, or $5,000 riage agreement, since that was the Club rate 81.00 per month. Mrs. Blase Are they? UATITNT I.AWVaWITM- the redemption of tho world. There each for tho conviction of Youtsey 1.303 Seventh St.. Washington, D. C. time when we first decided on our Mrs. Highupp Yes. They are is too much dogma and not enough and Howard, and Armstrong & wmmmmmmmmmi iuturo course. living next door In a New York do. An the old Indian said when hb Harding filed a cross petition asking Hartford Pressinfl Bltlti. ..fni..1tn(V .i.. SiBiemeuv io6iui"b Mil rA- - apartment house now. "w niy aa killing the mission- that they bo adjudged tho $10,000 apologized for Y. M. C. A. Bldg., latlons may seem strange to many aries: "They talked too much God reward instead of Griffin. All three "Why Experiment Dr. Bell's AntisepticSalve persons, and It may be asked why is a aro detectives and all did a lot of has and not enough bread." There Good for all Skin Diseases. married, If When Dr. Bell's wa should call ourselves over crying need of religion but we need valuable work In securing testimony we do not sustain tho ordinary re- been tried with satisfaction for " 5 ! ! l" "J $ ! ! !" ! i ?" that exists in deed more nirnlnst tho convicted men. lations of husband and wife. I can sixteen years In millions of homes the kinddogma. Wo want a religion The Judgment for $5,500 will bo! croup and all than In only answer by saying that we are for coughs, colds, softens the step and turns the dlvidpd" between Griffin and Arm-- j both believers in the power, of tho throat and bronchial troubles? You that Bell's Pine-Tar-Hon- ey voice to melody and Alls the eye stronc & Harding, each receiving Dr. will and the domination of mind can get it anywhere. Look for tho For Coughs and Colds m with sunshine and checks the lmpa-- ( 12,750. This is the first reward J over matter, and that we hope, by bell on the bottle. IIS Dr. Pierce's Favorite Prescription ji a St. habit-formin- Equivalent. J KENTUCKYi Light and Power Company E. G. BARRASS, MGR, I3Iax'tioxd.3 Ely. i son-in-la- Will wire your house at cost. Electric Lights are clean, healthy and safe. No without home or business house should tvhen within reach. them mt ssiorsari SMnessffifoimsfsrxfen ""-"vrt VJ?wr7nz CJJ )() lMMV7 Gre&lltldfYl&U '&4 J3ov3g and" i!arswrt& HAVE A ROUGH RIVER TELEPHONE Long Distance Lines to-d- post-ofllc- J. -- C as self-detec- ht m Scott's Emulsion et P. Barnes uiaiit i44i,,l',l,I,4,,I,,',J CLEANED and n, PRESSED. 4r lt - ri 0. SWIFT & CO. j w A ey -- Hartford, Kentucky. Subscribe for The Herald; $1.00 a y'r ,4iiii fumfrSUBi J eW ,c-v"- 7P ...Ta.J " jt 'uwHi 'wwr'1''1' te The Hdrtjord Herald HEBER MATTHEWS, FRANK L.FELIX. EDITORS. fRANK L. FELIX, ant and summer resorts In Kentucky, and It Is expected that this will be the most largely attended meeting In the history of the As sociation. AN ILLUMINATING In the arrest of the McNamara brothers, charged with participation in the dynamiting of the Los Ange- Which Outlines Meaning Entered at the Hartford les Times plant, and, otheV outrages, as mall matter of the second class. and the alleged kidnaping of the of Reciprocity. men to effect their transportation 3IAY to California, It is well that the pubWEDNESDAY lic suspend Judgment until they are LUMBER HUD PAPER TRUSTS tried and convicted by conclusive! NOTICE, DEMOCRATS! testimony. If they are guilty, there Democratic State Primary Is no punishment too great, while If The Only Interests ThatWould Saturday, July 1. they are Innocent, a terrible outbe Hurt The Farmers rage has been perpetrated, the main by oreffects of which will be felt FOR SALE, Benefited. Pnb.tnd Prop'r. post-offl- LEnERPREPARED .. --on any item.whether included mmmmmmmmmmwmmmmwiriifv-vwmmmmmtreaty or not, whenever Canada Is willing to put them on her freo list. In other words.we express a willingness to move toward free trade with Canada as fast as Canada may desire. This Invitation applies only to Canada, however, and the object Is the promotion of tho friendliest pos be Intercourse sible commercial tween the united States ana our neighbor on the north. In-th- e ...... .. -- Mm .X. .. 1 1 J a. Ifc llf ift lllillt Now Going On CENTERTOWN. May 2. This seitlon was visit ed last Saturday evening by the rain and hail storm In heaviest years, which did great damage to fencing and bridges, also to some Rosenblatt's KWWrWH mm orchards. Mrs. B. J. McKlnney and children, of Paducah, are visiting her parents, Mr. and Mrs. Foster McKlnney, here. Mr. E. S. McMillan and daughter Alta, are In Logan county, at tho bedside of Mr. McMillan's mother-in-lawho Is not expected to live. Richard, Infant son of Mr. and Mrs. Robt, Durham, is very sick. Mr. J. C. Igleheart, of Smallhous, was in town last Saturday. CORRECTION OF STATEMENT IN A DEPLORABLE AFFAIR Narrows, Ky., May 1, 1911. A good Country Campbell Cylinder by a Has been displaced Press. Will Cottrell. large cheap. For further particulars sell tf address The Herald. It'll soon be time to dig for There are few to chlg-ger- s. doubt how splendidly the "recall" would apply to the present Governor of Kentucky. will be" few Republican There 'candidates who will "point with pride" to Kentucky's recent or seems to be our now. . It Is announced that the Dutch have taken possession of one of the islands. Let's just let Philippine 'em take the whole bunch and not say anything more about It. names properly principal offense present administration. Kentucklans will perhaps be Interested In the fact that the census returns show there are fewer people In Paradise now than there were ten years ago. War with Mexico seems hardly probable at present. Our failure to pronounce some of their "proper" Jut Is One thing about being President Executive gets a free that the Chief pass to all of the big ball games. inHear that, young man? What an centive to strive for the goal! On the seventh page of the Herald ' y will be found the full text of measure Canadian reciprocity the Congress. Read It and now before you will know exactly what the bill to-da- ganized labor. It Is a case In which big money rewards figure, and monTHE TALE ey will sometimes do strange things SOME FIGURES TELL In the name of the law. By Clyde H. Tavenner, Special The Hartford Republican hands Washington Correspondent of The Gov. Wlllson this nice little pack- Herald. age: Washington, April 29. CongressDispatches from Washington man Dorsey W. Shackleford, of Misstate that Governor Wlllson Is souri, a member of the Ways and writing letters to the Kentucky Means Committee, has prepared one members of Congress In an efof the most Illuminating letters on fort to defeat Judge O'Rear for reciprocity that has yet appeared. the Republican nomination for The document has caused much faGovernor. Gov. Wlllson might vorable comment among members of as well be writing letters to Congress and Is to be widely circuSouth Africa for the same purlated. pose. His opposition to O'Rear "The lumber trust and the paper of his great Is one element trust are waging a fierce fight strength with the people. nenlnst reciprocity." says Mr. Shack Pity the Republican had not leford. "They are making desperate thought of what a failure as a Gov- efforts to get the farmers to Join ernor the alleged tobacco trust at- them. Wherever possible they have torney would make, when It was vo- enlisted the papers which circulate ciferously championing his candida- among the farmers. Thoy try to cy for that place several years ago. make the farmer believe that, by It certainly knew as much about his reason of the tariff,' he gets more Inefficiency then as It does now. than the fair market price for his products, which Is untrue. "Canada has a tariff which operates against our products sold In We have a tariff which Canada. operates against Canadian products IjjjjjjjjjjjjjjjJjjjI HBngr sold here. Reciprocity Is an agreement between the two countries to modify both tariffs with a view to more extended trade. "in spite of these obstructive tariffs a large trade has grown up between us and Canada. In Ave years ending June 30, In goods of all Selling Out Sale! Going to Quit Business mmm mwmu 4 1 S Entire new $ 0,000 stock to be sold at 4 50 cents on the dollar. Editors Herald: A communication to your paper last week, under e and a Barrett's Ferry signed "Citizen," was so misleading as to Important facts In the deplordate-lin- SALE BEGAN Monday, May 1st, I AND LASTS THIRTY DAYS! g All goods going at sacraf ice prices! Better come NOW! We are next door to Bank or Hartrord. g m m kinds We sold to Canada... .$8S6,417,3i'. 393,913,073 Canada sold to us I. ?1 Difference In our favor $492,503,703 TEAT SATISFIES. "Any country which buys from us County Fair should The Ohio more than It sells to us Is a good withhave another exhibit this year country to trade with. No tariff out a doubt. Let us hope that the wall should stand between us and proper enDENXY P. SMITH, officials will be given the such a country. charge Is based, appeals with as litOf Trlcn County, couragement and that they will not statistics for five "Government tle force to reasonable men as tho Authorizes his announcement as a In the matter. hesitate opponents of union labor who accept Attorney General of vears ending June 30, show these candidate for Col. Roosevelt declined to name Kentucky, subject to the action of things: IS THE SEST COURSE such a charge as conclusive. There X POSITION OF LAnou IN Kentucky" triplets born at Cory-doHorses. are bad men In all classes, whether , the primary, July 1, the Democratic THE McNAMARA CASE $14,172,075 of organized labor or capital. We cannot understand the 1911. We sold to Canada 2,549,201 In Regard to the Accused Union Whether the McNamaras are the Colonel's tactics In keeping out of on a farm Canada sold to us Mr. Smith was reared Indianapolis, Ind., May 1. Samso much of late. fiends the detectives claim them to the ltme-llgIs In every In Trigg county and uel Gompers, head of the American Labor Men A Fair feeling well. be, or tbo victims of misdirected Probably not self-mapaid his Difference in our favor. $11,622,874 Federation of Labor, in an Interview man. He sense a Cattle. zeal by detectives, or tho victims oy worn outlined the stand of labor Statement. The editor of the Leitchfleld Ga expenses at state college $1,578,179 even of the black conspiracy labor Wo sold to Canada after case. Though In the McNamara zette Is kicking because the census on the experimental farm, and study, Canada sold to us 1,193,796 people proclaim them, can only bo county only S3 live years of hard labor and pledging the support of the Federa says returns give Grayson The Courier-Journdetermined by a thorough sifting of pain In population In the last ten graduated with honors In June, Difference In our favor.. $ 384,383 tion to the accused men, he said la paragrai.h o the evidence before a judge and The concluding per cent, of 1893. He is now a member of tho bor was presuming nothing above years. He says live McNamara's public state- Jury, not by fragmentary hearsay Ment nnrt Dalrv. University law presumes the John J. this Increase has been furnished In Board of Trustees of the $17,011,017 the law. "The We sold to Canada ment Is commended to all who are gathered by newspaper reporters. they are of Kentucky (formerly State Colhis own family.. 904,191 men are Innocent until remarkable case: It will be the part of fairness as lege) and as a member of that Canada sold to us proven guilty," ho said. "We know Interested In this am also confident that It Is well as wisdom for evervbody to act Is beginning to take Board, assisted in making the State "I Old Hartford men, and do not believe them the on her perennial bloom of flowers College a University. To work one's Difference In our favor. $16,106,826 guilty, but In the belief, we are not not asking too much of the public on McNamara's suggestion and sus town has the way tnrougn a college Judgment In these mat- pend judgment until tnere is an opy. nrenristtifffl. The nml lnndscane. going above the law. Our aim Is to to suspend "ai iuc per $31,596,556 ters until opportunity for a full and portunlty for the formation ot reputation of being one of the pret-tlp- st hour to graduation and within fif- We sold to Canada men aro given a fair 6,679,884 see that the has been afforded." In the country anywhere, and teen years thereafter serve on the Canada sold to us trial. The arrest and subsequent fair defense be well on all sides to just judgment. It would each years adds to Its well known Board of Trustees and assist In events are enough to arouse suspicA Burglar's Awful, Deed prestige In this respect. making that college a University, Is Difference In our favor. $24,916,672 ion that this Is not contemplated. suspend Judgment as to the guilt May not paralyze a homo so com"You ask why Canada favors re Funds will bo raised to Insure tho of the men charged with this hein- pletely of as a mother's long Illness. Henry E. Huntington, of Los An- a record seldom found In the life until the evidence ous conspiracy ciprocity If It Is to give us the best men Justice." do- a farmer's boy. geles, Cal., paid fifty thousand has been adduced and weighed in But. Dr. King's New Life Pills are a bar, of It on these products. Here Is the Sixteen years practice at the splendid remedy for women. "They llars for a rare copy of the Bible. Of court AN INCOME TAX NOW County Attorney of answer: course the book he bought, being a two terms as nut that la lust what has not save me wonderful benefit In const!- PRACTICALLY ASSURED years as "First. The Canadian tariff is precious curiosity, will seldom be Trigg county, and seven Canabeen done generally by those who PaUon ttnd female trouble," wroteAttorney of his added to tho price which the seen by the race of men, but what Commonwealth's Mrs. M. C. Dunlay, of Leadlll. Tenn. The Income tax amendment of the have read the story as brought out now holds) dian consumer must pay. Canada If ailing, try them. 25c at James-H- . a volume of Bible doctrine could district fa position ho among the have fitted Mr. Smith to discharge desires to relievo her people from Constitution, which was a plank In in the newspapers. liavo been propagated Williams. m On tho one hand are those who General with this extra price. the last Democratic national platnations of the earth with that large the duties of Attorney Canada' Is willingin the alleged to form, has now been ratified by thir- place full credence "Second: Prominent Prea'Iitr Dend. credit. Being a lawyer of ability sum of money! t Elder W. E. Mobley, one of and a man of attainments, If nomi- take her tariff off the goods which ty States. To lnsuro Its acceptance, outgivings of the detectives as they Dr. Ben L. Bruner Is said to have nated and elected ho will make the we sell to her If in turn we will take thirty-fiv- e States are necessary. Only find their way through the indirect widely known ministers of his ear turned towards tho Repub- State an efficient officer. He Is a our tariff off of tho paper, wood four States Louisiana, New Hamp- channels of the press, and condemn Church In Kentucky, suclican gubernational phonograph and Democrat who has faith In the par pulp and lumber which she sells us. shire, Rhode Island and West Vir- without a hearing the men charged cumbed to a lingering illness InciIt is evident thnt ho would like ty and In Its real mission for purer If our tariff against theso products ginia have declared themselves In with these almost unbelievable dent to old age, Anrll 22, at his mighty well to hear his name ring- and better government, and believes were removed she would sell us a the negative, This leaves twelve crimes. home at Elkton, Todd county. On the other hand are tho brothing on the political record. Ho Is we should make an aggressive fight still larger amount of timber pro- States from which to secure the necDr. Dell's Antiseptic Salve listening and says his candidacy de- In tho fall campaign upon Wlllson-Isr- a, ducts than" she now sells us. How essary five votes to make the amend- ers of these men in the union labor who, with no more Is, guaranteed for tetter, ringworm. pends altogether upon whether any graft In can that hurt the American farmer? ment a part of the Constitution. An organizations Republicanism and knowledge of the real evidence than eczema, chapped hands and lips, "Who, then, would be hurt by Income tax Is practically assured. of tho other Republican candidates Kentucky. I tell you. reciprocity? The lumTiave slipped some of tho planks that of the other class, jump with running sores, ulcers and In fact all -O equal precipitancy to the assump skin diseases. Good to use after ber trust and the paper trust. Reci- TO SPEND 810.000 ON from his alleged platform. METHODIST CHURCH. 25c a box. RELIGION IN KENTUCKY tion of the Innocence of the accused shaving. m procity would bring Canadian 'lum One of the worst menaces of the and. the further assumption of a 8ENTENCE POSTPONED ber and paper hero to be sold in y Is tho Third public welfare Richmond, Va April 29. Reso- heinous conspiracy against organizThe subject for consideration at competition with tho American lumUNTIL CROPS ARE IN" House, which convenes with the as- prayer meeting Wednesday evening ber and paper. This, would give tho lutions appropriating $35,000 for ed labor. sembling of almost every legislative is "Tho Now Birth." Let all bring American people cheaper paper, and special religious extension work Both classes mako a very serious Richmond, Ky., April 29. James body. Its members are tho lobby- their Bibles and read on the subject. tho y by the mistake: the first in accepting a farmer cheaper lumber tq build were adopted here Slagle, of Jackson county, who was who stand llko Preaching both morning and evenists and brlbe-glveof the mero Indictment of union labor houses and barns. So you see why Board of Church Extension evil angels at the Bide of many hon- ing next Sunday. Sunday School at it is the trusts are making such fran- Methodist Episcopal Church, South; men as a presumption of guilt, and found guilty on the charge of moon-shiniin the Federal Court est legislators. Their presence Is 9:45. Tho public Invited to all tic efforts to defeat reciprocity. Thoy $10,000 for a fund of $60,000 to be tho fecond in making such an in- was told by Judge Cochran to go both recognized and felt, but their at Seattle Wash.; $10,000 for dictment a presumption of Inno- home, put in his crop desire to hold a monopoly of tho raised abqllshment Is one of tho serious American lumber and paper mar- work In Oklahoma City; $10,000 for cence. There would be no such here next fall to receive and return sentence, For All Bowel Troubles problems that confront tho law-ma- k Let the farmer be of good the mining section of Kentucky, and mistake on the part of the lrst Relief Is kets. Use Dr. Bell's Anti-Paiing bodies of tho present time. class if all union labor men were He Is not tho fellow who $5,000 for Key West. For a burn apply Chamalmost instantaneous. Is also good cheer. The board adopted tho report of capable of crime in the flgb for berlain's Salve. 'It will allay the At a meeting of tho Executlvo oxternally for all kinds of pains. will be hit by reciprocity. He will commission for tho building of their organization, as there would pain almost lutaatly and quickly Committee 6t the Kentucky Press Sold everywhere. m be helped. The lumber trust arid the the parer trust are tho ones who tvM a representative church at tho No- be no such mistake on the part of heal the injured parts. For sale by Association, held in Louisville retional Capital. the second class If a' I union labor all dealers. Edwin P. Moitow, United States feel the weight of tho measure.". nr cently, Cerulean Springs, In tho Of the $275,000 desired, $1?7,-857.men were Incapable of such rlmo. Practically the only change made Ull for tho Eastern northern part of Trigg county, was District Attorney Is in sight The commission The labor organization, therefore, decided Upon as tho placo for hold- district of Kentucky, in a signed in the Canadian reciprocity agreemeeting of this card issued Wednesday, announced ment by, the Democrats in tho House was instructed to begin tho actual which at once brands as an Infamy ing tho any charge made against any of Its thejMEWS-w- e Association this year, and ,the time that ho would not become a candi- was the addition of a clause author- work at once. . mombers, without knowledge as to inclusive. date for the Republican nomination izing the President, by executive act, of meeting June 19-2to reduce the tariff of this country, Subscribe for The Hartford Herald. the actual evidence .on which the most pleas- - for Governor of Kentucky. Cerulean is one of tho means. able experience of Mr. Monroe Harrison's little girl with a rape fiend, that the parents of the child have asked me to prepare an authorized statement of the facts for your pa-per. W "Citizen's" statement complained that: ho (Grant) was allowed to plead guilty to an entirely different j offense from that commuted, witn-onotifying the child's parents." The facts are that the child went before the grand Jury and made a full statement of the facts and the finding of tho court was In accordance with the child's testimony before the grand Jury. The parents of the child and citizens here regret that the law limited tho punishment of tho defendant to so short a term, but at the same time they realize that the court could not, under the limitations of tho law. Impose a greater punishment for the crime STORE committed. m Your correspondent Is a gentleman of high character and wrote with tho best intentions, but he had been misinformed as to the degree of the crime committed. "SUSPEND JUDGMENT" J. H. THOMAS. ut , ... , , ROSENBLATT'S TEE f 7 n. ht to-da- y, al J 1 - tho-mos- r to-da- to-da- rs ng r-- - to-da- yt n. in orrk,' 50 pid-summ- er Send The Herald 3, appreciate it wil j J. '? uflfcrtjm HMI FAIR'S I Exclusive Styles I -- -- t X ; . We certainly feel very much gratified over our immense sale of Ladies' and Men's Oxfords. Although the weather has been cool and unsettled, our steady sale of these goods go on, thus showing that folks who care for style and value, know where to make their purchases. A word about our Patrician Shoes for m Ladies. There is snap and style about tnem tnatare not Touna in otner lines. Then the wear none like them for it; fit the foot PERFECTLY and HOLD the SHAPE. Twenty years' experience with our Priesmier line, for a cheaper grade shoe, gives us an opportunity to KNOW SOMETHING, so we can say that WE POSTIVELY KNOW they will wear. A new pair if they do not. BE WISE, examine our Shoe stock before buying and remember it pays to trade with a nouse that saves you money. Jtfr. T. O, Trogden and daughter, gasoline engjne room also suffered Miss Cora, of Beda, gave The Her- In the .flames. Mr. Ersklne Fulker-so- n, a 'tenant on the farm, lost two ald a pleasant call while in Hart-for- d horses in the burned barn and a yesterday. cow was so badly1 burned It is not Tickets for Dr. Porter's lecture thought she will live. The total loss Friday night are on sale at Ohio was about $2,000, partially covered County Drug Co. Griffin's old by insurance. stand. Only 25c, children 10c. An election for two trustees In COMPLIMENTS DR. PORTER AS SPLENDID ENTERTAINER Hartford graded common school will be held at Hartford College Lexington, Ky., April 29, 1911. .building next Saturday afternoon. Rev. J. W. Bruner, Hartford, Don't fall to hear Dr. Porter at Ky., My Dear Sir and Friend: Rethe court house, Hartford, Friday plying to your favor of the 27th, I night. Bright, entertaining, witty, beg to advise that I have known Dr. elevating. It will be a rare treat. J. W. Porter In the Sunday School Best room, in the pulpit and on the lecChickens got the gapes? gape remedy on the market. See ture platform for three years, and James H. Williams, the druggist, In my opinion he has no superior and they'll never gape again. 25c. in Kentucky. In the pulpit ho Is perfectly at Do not miss the Big Selling-Ou- t Sale by going to the wrong place. home and I believe I have heard Remember we are next door to the him deliver the greatest sermons I have ever listened to. Bank of Hartford, Main street. I have also heard Dr. Porter In J. ROSENBLATT. lectures at the State University and Old Papers, Lots of 'Em For sale other places and as an entertainer at The Herald office. To go on and Instructor ho can not be excellshelves or under carpets or for blast- ed. He combines Instruction with ing purposes. Five cents per large entertainment, which a very few do. package. tf Dr. Porter Is a perfect gentleman intellectually su Mr. Charles E. King, of The Her- In every respect, ald's mechanical force, spent Friday perior to most of us; an orator of and aSturday in Owensboro, visiting ability and a lecturer whom the peo friends and relatives and attending ple of Hartford cannot afford to miss. I am sure they will never rethe circus. design book of F. Walker gret having heard him and it will Floral be well worth their money. & Co., of Louisville, and can furWishing you and your class all nish floral designs for funerals and of the success possible and hoping special occasions. to be with you soon, I beg to reE. T. WILLIAMS, OTTO C. MARTIN. main, Hartford, Ky. 13tf ODD FELLOWS CELEBRATE THEIR 021 ANNIVERSARY One of the most pleasant and enjoyable events that has occurred In lodge circles In Hartford during recent years jWas the event In celebration of the 92d anniversary of the founding of the Independent Order of Odd Fellows, which trans pired under the auspices of Acme Lodge No. 339, here last Wednesday afternoon. There was a splen did attendance of the local member ship, which was augmented by the presence of a number of Odd Fellows from other lodges In the county, with a sprinkling of visitors not members of the order. A fine program was arranged and carried out, which Included solos by Mi3ses Hettle and Ruth Riley and Miss Sue Wright. Mrs. Emory Schroder presided as organist and Mr. Schrceter also rendered a violin selection. All the music was good Splendid ad and much enjoyed. dresses were made by Messrs. C. M. Barnett, G. B. Likens and Rev. J. W. Bruner. Following the rendition of the program, delicious sherbet, ice cream and cake were served. At the conclusion of the affair, the crowd assembled in front of the hall on Center street, where a large group picture was taken by Photographer Schrceter. Hartford Lodge of Odd Fellows Is In a flourishing condition and has a large and increasing membership. Ly Maku Mintt Baking; Easy pOYAl POWDER The only baking powder Absolutely Pure made from Royal Grape Cream of Tartar HO ALUM, HO LIME PHOSPHATE OOOOOOOOOOGCOOOOO C RESOLUTIONS ()'" RESPECT O OOOOOOOOOOOOOOO Hall of Hartford Lodge No. G75, & A. M., Hartford, Ky. Whereas, Our brother, W. II. Griffin, departed this life on the 20th of April. 1911. Resolved, That In the death of Bro. Griffin, his family has lost a true, faithful and devoted husband and father, the community an honorable and respected citizen, the lodge a true and devoted brother. cow ' theso Resolved, That F. James U. Park, carrier on Hartford Route 5, and Miss Beat rice Newcomb, daughter of Mr. C. living on Route 5, N. Newcomb, were married in Louisville last Sat urday. Prof. T. H. Smith, vice president of Hartford College, visited his family. at Madlsonville Saturday and ,Mr. POST-OFFIC- I ! I A r"4.' Jz6q iBiHHBiHBBHHMHPHmi I I $3R$ Sundsif. He was accompanied home by his daughter. Miss Elena, who had been visiting him here. Two handsome presents, each valued at $6, will be given away absolutely free each Saturday by the Ohio County Drug Co. Griffin's old stand. For every dollar's worth of goods bought you get a chance. Lightning Sunday night struck a owned by residence at McHenry Messrs. E. T. and C. M. Williams and occupied by Claude Wakeland and wife. The building wbb partially wrecked but nobody was hurt. There was Insurance to cover loss. Correspondents of The Herald Please give the residence of all visitors whom you name, also the residence of the ones they are visiting, and mention only those who go to or come from a distance. People who visited their neighbors is hardly considered news. COFFEE No. l-- SPECIALS! These Prices are Good for One Week Only. 20c 2-- EMPLOYES TO HE BUSY DURING MAY U. C, V. RpjinJojou JJff J Jtock Ail:., May 1.1th to 18tli. Owing to an order of the Post For the above occasion, the L. & master General which has been re- N. will sell round-tri- p tickets nt e, cently received at the Hartford $19.15, dates of sale. May 13th and the postmaster and post-offi15th. clerks will have a lot of extra strenFlnnl Limit of Tickets All tickuous work during the month of May, ets will be limited to reach original which began Monday morning, and starting point returning, not Inter will receive no' extra pay for it. than midnight of May 23d, 1911, In an effort to And the actual unless extended at Little Rock, by work done in the in the depositing ticket with J. E. Henne-gaUnited States, the PostmastcrGcneral special agent, with p fee of has ordered that each piece of mall liftv cents, before May 23d, ticket matter. Including first, second and will be extended to tinal limit to and third-clas- s mall, bo weighed, and including Juno 14th, 1911. Any the number of times it has been one desiring to attend this reunion, handled and the. time required to will please adv'se me three days be-- 1 hnndle it be recorded. The order fore date of going, so as to secure directs that each man handling mail tickets. matter keep a correct record of the 17t3 H. E. MISCHKE, Agt -- i times the mail matter has been . Subscribe for The Hartford Herald. handled and the time required to do so. The rural carriers as well as the e clerks, are Included In the order, and all will be busy during the month of May. The clerks L will have to keep a record of all the things required for the entire month, and will be graded accordingly. E post-officpost-offices n, Attorneys Barnett & Smith, Heav- rln & Woodward, F. L. Felix, J. E. Fogle and Judge R. R. Wedding, of Hartford, are in i attendance at the Federal Court at Owensboro. resolutions pe fnrnls'iejl reaved famllv, that they be published In each of our countv inner? and tho Masonic Home Journal. J. P. SAXDERFl'R, C. M. BARNETT. F. L. FELIX, Committee. SPECIAL tojhe be- PHICE50N FLOUR. rated), The Hartford Mill Co., (IncorpoIs making a SPECIAL CASH PRICE OX Fl Ol'R for 30 days. 1 toll. Fancy Patent Flour. . . 1 bll. Straight Patent Flour. .SI. 75 1 bll. Straicht Grade Flour. . .SI. U"? SPOT CASH nnd no Remember goods delivered at these prices. Ev.S-..0- erything guaranteed. lCt4 Yours truly, W. H. RILEY. , post-offic- ikfS& nmMwiwwvwuMiwvtw W I 18c rho local M., H. & E. train due Several of the young men of this Special 22c- - here from Madlsonville at 7:35 a. city entertained Wednesday evening Speoial No. 250 25c. m. was delayed about four hours at Dr. Bean's skating rink with a Talleho-3- 0c Special evening was dance. 30c. Monday a few miles from Hartford spent by A pleasant present were: Mrs. Rorers' 85c Special of a heavy landslide on account all. Those 45c. which covered the track. The train Yours Truly 2 25c pkgs Misses Mary Bell, of Owensboro: 45c. had to run back to Moorman for Elena Smith, of Madlsonville; e 25c pkgs Arbuckle- -2 Smith, Stella Woerner, Beatrice $1.00. help to clear the track before pro4 lbs. 80c Peaberry Haynes, Mary Marks, Louise Phlpps, $1.00. ceeding. 4 lbs. 30c Guatemala Dinner Set Katie Pendleton, Mary Spauldlng elegant These Coffees ajl possess that fino'rich aroma and flavor or Anhandsomo Chamber Set and Mr. and Mrs. R. T. Collins; a Beard, and that just pleases the appetite. You will never know how each worth $6 will be given Messrs. Will Duncan Park, Mr. G. E. away free each Saturday by the of McHenry; Estill them". good they are until you try Harold Holbrook, L. T. Riley, Wll-ly43-ple10-pleI Entcitnln With n Dance. Corset Facts nvvtwvvwvvtvi.vvwxvwvwvvvvv A Bar-ras- s, HARTFORD GROCERY COMPANY. 3 Time TaReaver Dam, Ky. ble at South Bound. North Bound. t No. 1334:05 a.m. No. 12111:35 p.m. No 12212:28 p.m. No. 1012:48 p.m. No. 102 2: 48 p.m. No. 1318:55 p.m. J. E. Williams. Agt. Illinois Central Railroad I' Don't Selling-Ou- forget Sale Rosenblatt's now onl big t Newest things in Ladies' Belts and Neckwear at Barnard & Co's. Flowers and Flower Pots for sale 13tf by E. T. Williams. Hartford, Ask for Colgate's Tinted Talcum Powdor at Barnard & Co's. Just outl Young man, - ft? "Frat" Clothing nev-On- ly l'4 , t or disappoints. Co's. at Barnard & Miss Fern Curtis has accepted a at Qenter-tbw- n. position in the post-offi- ways j. W. Ford'a Meal and Flour alto be had at Moore & Son's Meat Market ' ..:.- - m' Mr. Spurrier Ford, of piaton, was pleasant caller 'at The Herald of a fice Saturday. Rev. L, W. Tlchenor, of Center-towhas purchased the undertak- ' iBgeetabllshme-n- t of Dr. Chapman, of feat plae. and will conduct a gnral undertaking business. n, Ohio County Drug Co. Save your tickets on small purchases. When Henry Griffln, Trimble Pendleton you get a dollar's worth you get a and O. T. Burns. guess free at these valuable prizes. Unanimously Try your luck! On the 28th ult. the Ballard Three of the Democratic candi- County Board of Education unanidates for State offices were in town mously elected Prof. C. C. Justus Window Shades that are differ- last week In the persons of Denny P. as principal of tho county high Smith, of Trigg county, for Attor- school at La Center, Ky. This Is ent? Barnard & Co. Hand-madney General; R. S. Eubank, editor quite complimentary to the former any length or width. of Southern School Journal, Lex- principal of West Kentucky SemiRemember you get new ington, for Stato' Superintendent of nary at Beaver Dam. His ad. will goods at Rosenblatt's during this Public Instruction, and Frank P. appear In theso columns next week Big Selling-OSale. Hager, of Palntsvllle, for State Au- in connection with nice property at Beaver Dam. Mrs. C. H. Evans, of Evansville, ditor. Ind., is the guest pf her parents, (The case of A. B. Baird against Church Is Completed. Rev. and Mrs. W. B. Wright. Ohio county, whereby the plaintiff The new Baptist church at Conmoney on an cord Is completed and as soon as Don't fall to try a sack of Gold Is seeking to collect Flour, guaranteed to give old note, which has been on the tho paint dries will bo ready to be Medal docket for some time, came up at used for. services. It will bo rememperfect satisfaction, the term of Federal Court which bered that the old church was deW. H. MOORE & SON. Monday. Owensboro opened in just wonderful Wunderhose how Quite a number of witnesses from stroyed by Are some time ago, That they wear. Cost no more than the Hartford and vicinity were sum- before the hour for service. day stops were taken for tho reones that do not. moned. building, and a building committee BARNARD & CO. Woerner won the was appointed. In less than two Miss Stella Wo have Just received another handsome chamber set given away months a beautiful church has been barrel of Jumbo Pickles. Also fresh by tho Ohio County Drug Co. last erected and the members are Justly supply Premium Cup Coffee. Saturday. Her guess was 213, while proud of the new edifice. m W. H. MOORE & SON. the lucky number was 227. A To Correspondents, of tho affair who has strango Mr. Harry O'Bannon, In her "half minute talks" to the Ky., was that her sister, Miss Sophia, headquarters at Burkesvllle, ' County correspondents in the Cloverport Court has been visiting Jiis family here a deputy in the Clerk's office, had seen the lucky News, Miss Louise Babbage wisely the .past few days. figures in a dream the night before suggests this: "Try not to write VSupt. Henry Leach and little son, and had insisted upon her sister about tho same people every week Hintori, left yesterday for Bowling guessing them, which she did, and unless they cut off their han,ds or Green to attend the convention of won. feet or do things unusual. Inquire county school superintendents In aboutpeople you have not seen for Lightning struck tho barn of Mr. a long time, and I bet you will hear session there this' week. Nat Llndley at Point Pleasant Sat- some news to write us." Mr. and Mrs. John W. Taylor are urday night and flames following the proud parents of a baby boy destroyed the structure, also a corn-cri- b For Sale Town property, vacant y dwelling. adjoining. One mule, a largo lots, cottages and that arrived Thursday morning. The youngster has been christened Wil- quantity of hay and corn and farm A. C. YEISER & CO., ing Implements were consumed. A liam Maxwell. Hartford, Ky. d. e, te ut two-stor- Wf - J i' AU..ilWVU : There are other corsets, but no corset is made in as many shapes as Warner's. A CORSET FOR EVERY FORM. If you haven't yet found the model that suits your form, ask for our large complete catalog. We will get the right one. If then, we cannot suit you, will get any make you desire. Warner's does not rust. No better Corsets made $1.00 to $6.00. r 7 i 1 h e 1 4' Ask us and- - J JfetfVn jjiiiniirjiipMWa)iwiiwifiii"i!,'!trMi:,jaB Rvrr, ' KwrMiiri m ,r "vmmrWMirnmMF'm '"w " B$W " The Harlford Herald WEDNESDAY M, MAY 3 TA-DU- 3 II. & E. HAILKOAD TIME AT HARTFORD, KY. ..Time tabic effective Sunday, Dec. 4th,rontalns the following schedule: No. 112 North Bound due 7:20 a. m. within Its folds. For proof of all this, wo refer you to the Hon. J. Bogard Wyatt, gentleman from Marshall.who made himself famous over Kentucky and Infamous with the capital's citizens by solemnly asserting on the floor of the House that Frankfort was such a hell of a hole In the ground that It was necessary for a man to lay Hat on his back In order Murto see the sun at noonday. ray Gazette. A GREAT RUSH TO SELL BLOOD A Hundred Men in Line to Dispose of Quart I !. it- - 1 Dolly No, 114 Dally No. 113 Dally No. 113 Dally IHE ! i iw except Sunday. FORTHENOMINALSUMDF $25 .?bu North Hound due 3:40 p. m. except Sunday. It helps put flcstToil your bones and vitality into your nerves. SOCIETY NOTE. South Bound due 8:55 a. m. Nearly All the Applicants Told ciety Valve," by Emily Newell Blair. except Sunday. Pitiful Stories of Hard South Bound due 1:40 p. m. GATHERING OF BILDHEUDS The marriage- - yesterday of Lord except Sunday. Luck. Borrowmore, the titled English fortunII. E. MISCIIKE, Agt. e-hunter, to Miss Goldle DiviTO DISC0S5J QUESTION dends, the wealthy American title-hunt- MANY NOT DEEMED ELIGIBLE was a complete success In More than 100 persons answered 0! Momentous Importance to the Smlth-vill- e, every way. MEGiLLAH "My mother," writes Mrs. Z. L Adcock, of Long before daybreak the popu- the advertisement of Ml. Morlah "is 44 years old and is passing through the Term., Hairless and Those Wearlace began to gather In front of the Hospital, on East Second street, of C Church of the Sacred Shares. The fering $25 to the one who would anShe was irregular and bloated and suffered terribly. ing Whiskers. police had been notified and at 10 yield a quart of his blood In a transMy father stepped over to the store and got her a bottle o'clock 3,000 reserves were called fusion oueratlon on Mrs. Rosle Relsof Cardul, which she took according to directions and now ler, of 293 Stone avenue, Brooklyn. Washington. April 29. A Joint for to quell the disturbance. she is up, able to do her housework and says she feels plainly Why It Means So Aluch to Promptly at 1:30 the newspaper Although the advertisement was one debate, notable in the annals of the like a newlwoman." Try Cardui in your own case. correspondents arrived and took called for men only, there National Capital. Is to bo held In Medicine Co.. OatUaooj. Tea. Write to: Udlei' AdvUorr Depl, CfetUnoos Jewish People. their places at various vantage woman among the applicants. the Assembly room of the National ouuct. Home irawaenuor women. totSpecUllnttmctlon, Eight men were founcT eligible, Press Club on the evening of May began points. At 2 the newspapers to Issue extras and continued to do and were placed under examination 3. Senator John W. Kern, of Indi A STORY QFJEROIC CAREERS so at half-hoIntervals throughout a second time. Of these, two were ana, former Speaker Cannon, of Ill afternoon and well Into found to be almost equally qualifi inois; Representative Nicholas Long- the entire One was Julius Phillips, of worth, of Ohio, spoken of as possi- ,erJoyous In periods of personal suc- OOOOOOOOOOOOOOU evening. in Thrilling theAlthough the rehearsal had been ed. As Embraced He ble Ambassador to Germany, and 2G3 Penn street, Brooklyn. O TOEMS YOU'LL ENJOY. cess and achievement, nor yet too O held the day before, there was a pre- said that he was married and had Representative Ollle M. James, of despondent when tho gamo goes O Narrative of Esther and liminary ceremony for the benefit of two children, and had been out of Kentucky, one of the Democratic against him, keeping in mind always O The Herald's Special Selections. O ' the moving picture rights. This was work for two months. His wife, he leaders of the House, are to be par- tho supreme value of the average in O O Mordecai. held Just before the regular cere- said, had objected to his coming, ticipants. THE GLORY OF AGE. President Taft has dis- all things, will leave the world still The played the keenest Interest In the mony, In order that the crowds but he had come, nevertheless. so much In love with It that he THE FAMED I'l'IUM FESTIVAL might be Included. I said, doctors declared him a perfect phys- meeting, and Speaker 'Champ Clark would like to linger yet for awhile "What is the glory of age?" As Miss Dividends has never been ical specimen, but still they learned Is to be present In an advisory caof gold and a few dear "A hoard pastures. Seattle and fruitful Purlm has developed Into a festiknown to appear twice In the same the consequences to him. Tho other pacity. The debate, however, is to friends? val of many aspects In modern Jew-l$- b costume, she then went home and man said he was single, and that he be nonpartisan. When you've reached the day that fit, life. .UJsjthe time when the ' new-outLord fha'cflio family TeBpouslblHtlea,-- - Heyou look ahead The question at Issue Is of world WHISKEY WAS 4c. A PINT the poor, when donned "ah entire rich remember chatting pleasantly gave his name as George A. Allen, wide Importance. It Is this: "ReOTHER CURIOUS THINGS Borrowmore And see the place where your one another, remember friends reporters In the meantime. of 107 Nassau street. Brooklyn, a solved, That whiskers are a greater Journey ends. learn that religion with the when children At 3:30 Miss Dividends arrived and shipping clerk, and said that he had detriment to a man than a bald The Mount Sterling Advocate When Time has robbed you of youthprocessional and amusing ashas its published In a recent Issue some was Interviewed. not earned a cent for almost three head." ful might, pects, and when the position of Jews He was selected for the been placed facts In regard to the early history What is the secret of your delight?'" At 4 o'clock the ceremony took months. The affirmative has dispersion is seen to be typiin the we moke place and they all went home to operation. In tho hands of Messrs. James and of the State from which fied in the biblical narrative. And an old man smiled as he an- Nearly all of the applicants told Longworth, who long ago lost in- the folfowlng extracts: and after which perhaps the most character- breakfast, before But swered me; most of terest In the price of a hair-cu- t. Tho they made statements to the press. stories of hard luck, and "In November, 1798, the Kentuc istic feature of the festival is the "The glory of age Isn't gold or Shortly after dusk the happy cou- them, according to Superintendent negative will be warmly upheld by ky legislature passed an act requirreading of the Megillah both In the friends, Few of Messrs. Kern and Cannon. were Germans. The ing every white male over sixteen ple, accompanied by a retinue of re- Spector, home and In the synagogue service. porters, left on the honeymoon, an them would have been physically former wears a beard of the type of to kill a certain number of crows When we've reached the valley or The narrative thus read or told is Soon-to-b- e ocean liner having been en able to spare a quart of blood, some Justice Charles E. Hughes, while and squirrels each year. one of the most striking and most entire And note the place where thepurpose. R.Prlch- appearing as fit subjects the latter has a Lincoln-lik- e gaged for that hirsute of them "In May, 1833, Benjamin effective stories of the world, even Journey ends, One of them said adornment. As the couple is now well known for the hospital. ard, of Montgomery county, left regarded as a story. It records the given a quart of blood physician The glory of age, be it understood, It Is understood there that he had The debate Is expected to draw an his homo In search of a ups and downs of Interesting per- to the police. to save the life of a dying woman attendance from all parts of tho who could relieve him of superabun- Is the boy out there who Is makingsons and appeals thus to what Stev- will be no further trouble. good. In Mt. Slnal Hospital three months country, as the membership of the dant flesh. He was 42 years old and enson calls the aleatory Instincts of To Break in New Shoes Always Vftc ago, and that he was again out of National Press Club Includes many weighed four hundred and eighty- - "The greatest Joy that can come to mankind. Foot-Easthe antiseptic funds. But the condition of his of tho most prominent magazine three pounds. man, It is well known that servant Allen's powder. It prevents tightness and blood did not warrant a second and newspaper editors and writers "In January,- - 1839, the county When his sight is dim and his hair girls are especially pleased to read bunions, swollen, transfusion. Another said that he of all sections. blistering, court of Lewis county prohibited is gray, the dime novel which tells of the sweating, relieves tender feet. At druggists, simply wanted to get rid of an the sale of whiskey by groceries at The greatest glory that God can rise In fortune of one of their own There's a Reason Sample mailed free. Address, of blood, but an examination a greater price than two cents a half plan class who marries a marquis or a 25c. 18t4 revealed evidences of serious kidney For the large and Increasing sale of pint. It Is said that many men millionaire, according to the locale A. S. Olmsted, Le Roy, N. Y. To cheer tho lives of the old When abandoned the business as unprofit trouble, and this man left the hos- Dr. Bell's of the story. So, too, we all care to SPEAKING OF TOUGH LUCK, In the need of a cough medicine, try able. pital very much frightened. ' When they no more share In the bat read of the rise In fortunes of a deHEHE'S A CASE IN POINT When one of the trustees of the It and you will know the reason, m "In January. 1855, the current serving young man who becomes the tle yell, hospital heard of the extraordinary value of slaves was shown by several Is the boy out there who Is right hand of a great merchant or a The heirs of Hobson Burton in rush of destitute men at the hospital A SENTENTIOUS LITTLE sales which took' place in Clark and Prince. SERMON ON HOW TO LIVE neighboring counties. Buchanan, Mich., have been doomed he telephoned an order to give each The prices A similar Interest attaches to the to disappointment. Pine Tar and Honey applicant 50 cents as a reimburse ranged from $1,050 to $1,505. careers of Esther and Mordecai in Life lengthened to Its fullest Is Before his death, five years ago, ment for car fare and time spent In "During March, 1855, several Have been used for generations in of the Megillah, of the narrative short enough, and tho man who families In Clark county lost cattle treating coughs. Dr. Bell's Burton took the novel method of waiting. New York Times. which we can never get tired. The hidlives It out on straight lines, giving by starvation. Others sold their catcontains both combined has, of course, an- telling where his wealth was book of Esther lift for lift, and lick for lick, not ov- - tle at half what they cost two years with other valuaable Ingredients. den by talking into t phonograph To Mothers in This Town. other intorest for us. It records a having the record filed away Children who are delicate, feverThis was caused by the Look for the bell on the bottle. Bo before. crisis in the career of the Jewish and with his will in a lawyer's safe, ish and cross will get immediate rescarcity of corn, resulting from the sure you get Dr. Bell's. people and tells how this was avertfor five lief from Mother Gray's Sweet PowWHY SO WEAK? great drouth of 1854. of the Jewish where it was to remain ed by the years. ders for children. They cleanse tho maiden raised to the dignity of nows THIS? FOR FLETCHER'S Tho will told the heirs that he stomach, act on the liver, and are who beQueen, and her relative We offer One Hundred Dollars Rehad planted his fortune and that his recommended for complaining chil- Kidney Troubles May be Sapping came vizier of Its equivalent. ward for any case of Catarrh that can own voice would tell them the ex dren. A pleasant remedy for worms. Tlmos have so far changed that Your Life AwayHartford not bo cured by Hall's Catarrh Cure. act locality. druggists, 25c. Sample free. At all More Oppression. great events of this kind are not F. J. Cheney & Co., His wish was complied with, and Address, A. S. Olmsted, Le Rov, N. Little Willie What is leisure. likely to be Influenced bo closely by People Have Learned Ohio. Toledo, 1S14 pa? but Jews at not until Thursday did the heirs Y. single personalities, We. the undersigned, have known gather at the home of his son, Luke This Fact. Pa Leisure, my son, is the two least have always looked forward and And Yet He Died. F. J. Cheney for the last 15 years, phonominutes' rest a man gets while his to some such helper as Mordecai. Burton, to hear what tho believe him perfectly honorable in all wife is hunting up something eleo Oklahoma City., Okla. Awll 27 Every one who knew the late Dr. graph had to say. When a healthy man or woman be- business transactions, and financially they were all gathered In The body of an Indian boy with two When for him io do. Herzl recognized In him just such a heads, four arms and four lei; was gins to run down without npparent able to carry out any obligations made typo of a man who could speak his the parlor, the arrival of the lawyer causo.becomes weak.languld, depress- by his firm. discovered In a cave near Okmulgee, Subscribe for Tho Hartford Ilcrald. mind in the presence of Kings on with the record was announced. He backache, headache, dizzy Waldlng, Kinnan & Marvin, may entered the house and unwrapped Okla., yesterday by a farmer boy ed, suffers behalf of his people. And there disorders, kidney o. Wholesale Druggists, Toledo, while hunting rabbits. The body spells and urinary come a time when even the Czar or the precious nrtlcle In tho kitchen. weakness may be tho cause of It all. Hall's Catarrh Cure is taken Inter may have to As he stepped through the door Into Is nearly five feet tall and tho arms the King of Uoumanla The flesh Keep the kidneys well and they will nally, acting directly upon the blood were, he reach below tho knem defend himself in the presence of tho room where the heirs Kidney Pills and mucous surfaces of the system. tripped over n footstool, fell and on the bones has dried and appar- keep you well. Dean's some renresentatlve Jew. cure sick kidneys and keep them well. Testimonials sent free. Price, 75c per so many ently there has been no decay. Thus the book of Esther, besides broke the record Into Old residents In tho vicinity of Can Hartford readers demand further bottle. Sold by nil druggists. being nn Intelligent story in Itself, pieces that It was impossible to get Take Hall's Family Pills for constitho cave where the body was found proof than the following statement: say a word. has roots deep in Jewish feollng and It to Price Graham, Railroad St., pation. say they remember such an Indian someKy., says: "I can recom Jewish history, and It gives . O We don't mean just stop the irriFor soreness of tho muBCles, missing Tho Limit thing of the glow of romance to the whether Induced by violent exercise boy, and that he has been tation in your throat but cure the. mend Doan's Kidney Pills ns a remnearly ten years. American Hebrew. The services in the chapel of a festival. underlying cause. or Injury, Chamberlain's Liniment edy that lives up to representations. certain Western University are from Is excellent. This liniment Is also Cough syrups cannot do this. It J. M. Howell, a popular druggist For four years I suffered from dis AVlmt's the Use secretions time to time conducted by eminent takes a constitutional tonic bodyeyes when one highly esteemed for the relief It af of Greensburg, Ky., says: "We use ordered kidneys and the To suffer with sore clergymen of many denominations fords In cases of rheumatism. Sold Chamberlain's Cough Remedy in from these organs were builder to do the work properly 25c tube of Sutherland's Eagle Eye by m our household and know it Is excel- In passage, obliging me to rise sev and from many cities. druggists. all and cure you to stay cured. VmoL Wo guarantee Salve will cure you? . occasion when one of On one is the remedy you need. m eral times during the night. When lent." For sale by all dealers. pres It. You risk nothing. It's a creamy, Where .Tones Went. ever I cnught cold, it was sure to set these visiting divines asked the m snow white ointment. A series of revival services was HEBE IS rROOF-Mr- . A Continually Good Mngazlne. tle In my kidneys and greatly aggra- ident of tho university how long he Minnie Ogood, of Glens Fall, city, and being held In a Western Among all the changes and ru vate my trouble. My baok ached se should speak, that witty officer N. Y., write:- - "After trying (everal remJOHN MELOAN COMMENTS big placards giving notice of the mors of changes, In the publishing verely and when I stooped, I was edies for a bad couch and cold without CORKSCREW ON THE upon conspicuous world, Llpplncott's Magazine "pur- seized by sharp twinges through my services were posted In benefit, I wa ntbed to try Vlnol. It "There Is no limit, Doctor, worked like magic. It cured raj cold places. One day the following no- sues tho even tenor of Its way" Just loins. The ache in ray back at night the time you may preach; but If may Canadian of tho Every member tice was posted: "Hell; Its Location as It has for forty-od- d years, and greatly disturbed my rest and In tell you that thro Is a tradition here and cough and I gained In health and trength. I consider Vlnot tho raoit parliament has been presented with and Absolute Certainty. Thomas probably will for forty-od- d the morning-- I arose feeling lame and that tho most souls are saved durwonderful tpnlo and tuvlgorator I erer a corkscrew. In the Kentucky par- Jones, baritone soloist, will sing Just as It twenty-flv- e minutes." MIT." years more. The only change no- sore. I was very nervous, the slight- ing tho first liament members long ago learned 'Tell Mothor I'll Be There.'" I often felt May Llpplncott's. ticeable In It Is that It seems to be est work tired me and Kidney Pills If we cannot stop that cough. a bottle by tapthe trick of opening May Llpplncott's. getting better. The May Issue opens dull and languid. Doan's with VINOL our delicious cod Republicans There, It heavily on tho bottom with ping Some liver and iron tonic which is made with a complete novelette, of coarse relieved me in a short time and it After the big Andrew Jackson Now Is tho time to get rid of tho palm of tho hand. This prewithout oil we will not charge "Tho Tuharczln Case," by Edith required tho contents of but four Day' banquet In Baltimore, a prom tho cork Intact, and It may be your rhoumatlsm. find serves You will Macvane, who wrote "The Dutches boxes to effect a complete cure. I Republican thus greeted nn you a cent for the medicine you used to chew on when the liquor Chamberlain's Liniment wonderfulAdventures can say that this cure has proved inent buy, This seems like a pretty fair Democrat: n out, or during tho time when ly effective. One application will of DreamB" and "The aro gives equally laid in ' there were some proposition and ought to be acscalp bills are convince you of Its merits. Try It. of Joulou." Its scenes "I understand the dog tax or fox For sale by all dealers. Price 60 a small cepted. Don't you think so? With m Paris and In up for debate, and the lawmaker Is For sale by all dealers. Co., Buffalo. Republicans at the banquet last Bents. Foster-Mllbuthis understanding we ask you to but decidedly "fast" little town In unable to stop Into the cloakroom. Mew York, sole agents for tho United night." Savoy. yes," said the Democrat, ge- trv a bottle of VINOL. Kentucky member who owns a "Oh, Any There are some, noteworthy shorty States. For Sale, by Hartford Drag Co., nially. "One waited on me." corkscrew Is under suspicion of bethe name Doan's Remember FOR FLETCHER'S "Conscience In this lS8U0. atnrlns TuaraA1flilAa3 May Llpplncott's. ing so crooked that he uses tho tool K f Tybout ad take no other. by Ella Middleton J Money," for the purpose of hiding himself er, author, of "The Wife of tho Socre; tary of State," etc., Is tho first of a series dealing with various phases of Department life In Washington. These should be of extraordinary interest to the thousands of employees on the National Government's pay roll, as well as to those omploycd by the different States, who are sub jected to similar temptations and similar abuses. Other remarkable Adven stories are "A Spruce-Streture," by Clifford Howard; "The Instinct Eternal," by Stanley Olmsted; "The Dignity of Ellon," by Clinton Dangertleld; and "Tho Soet wonder how you can "main youn?, or whyhJrwonvw ottkr than you, look younger than youido? Preserve Tti secret can be put in a preserve youjJfouUi your health, and you will heath, but we mean not alone With, as, sometimes, magnificently strong-lookinerve Physically or nervously. ng The Secret of Youth r X "MSS j The Woman's Tonic CARDUI r x. BOOKjraER ur T i r - e, over-supp- ly i Pine-Tar-Hon- Plno-Tar-Hon- ey VOL self-sacrifi- Children Cry CASTORIA How To Stop rt. Stubborn Cough I well-know- rn Children Cry CASTORIA muff '. ;.-- . Reciprocity Act Favored by Canada and the United States I I J - f I i r N V: full' text of tho McCall bill Canadian reciprocity aa by tho houso of la as follows: Bo it enacted by tho senato and liouso of representatives of the United States of America in congress assembled, That there shall be levied, and paid upon the articles hereinafter enumerated, tho growth, product or manufacture of tho Dominion of Canada, when Imported therefrom Into the United States or any of Its possessions, except the Philippine Islands And the Islands of Guam and Tutulla, In lieu of tho duties now levied, collected and paid the following duties, namely: Fresh meats beef, veal, mufton, lamb, pork and nil other fresh or refrigerated meats excepting game 1 cents per pound. Bacon and hams not In tins or Jars, 1 cents per pound. Meats of all kinds dried, smoked, salted, In brine or prepared or preserved In any manner not otberwlso cents per herein provided for, 1 pound. Canned meats and canned poultry, 20 per centum ad valorem. Extract of meat, fluid or not, 20 per centum ad valorem. Lard and compounds thereof, cotto-len- o and cotton stearlne and animal stearlne, 1 cents per pound. Tallow, 40 cents per hundred pounds. Egg yolk, egg albumen and blood albumen, 7 per centum ad valorem. Fish (except shellfish), by whatover name known, packed In oil, In tin boxes or cans. Including the weight of the package (a) when weighing over twenty ounces and not over thlrty-sl- x ounces each, 5 cents per package; (b) when weighing over twelve ounces and not over twenty ounces each, 4 cents per package; (c) when weighing twelro ounces each or less, 2 cents per package; (d) when weighing thlrty-sl- x ounces each or more or when packed In oil, in bottles, Jars or kegs, 30 per centum nd valorem. Tomatoes and other vegetables, Including corn In cans or other air tight packages and Including the weight of tho package, 1V4 cents per pound. Wheat flour and semolina and ryo Hour, CO cents per barrel of 100 pounds. Oatmeal and rolled oats, Including the weight of paper covering, 50 cents per hundred pounds. cents per hundred Cornmoal, 12 pounds. Barley malt, 45 cents per hundred pounds; Barley, pot, pearled or patent, one-hacent per pound. Buckwheat flour or meal, one-hacent per pound. Split peas, dried, 7 cents per bushel of sixty pounds. Prepared cereal foods, not otherwise provided for herein, 17 per centum ad valorem. Bran, middlings and other offals of grain used for animal food, 12 cents per hundred pounds. Macaroni and vermicelli, 1 cent per pound. Biscuits, wafers and cakes, when sweetened with sugar, honey, molasses or other material, 25 per centum ad valorem. Biscuits, wafers, cakes and other baked articles composed In whole or In part of eggs or any kind of flour or meal, when combined with chocolate, nuts, fruits or confectionery; also candled peel, candled popcorn, candled nuts, candled fruits, sugar candy and confectionery of all kinds, 32 per centum ad valorem. Maplo sugar and maple simp, 1 cent per pound. Pickles, Including pickled nuts, sauces of all kinds, and fish paste or sancc, 32 per centum ad valorem. Cherry Julco and prune Juice, or pruno wine, nud other fruit Juices and frnlt sirup, nonalcoholic, 17 per centum nd valorem. Mineral waters nnd Imitations of natural mineral waters, In bottles or jugs, 17 per centum ad valorem. Essential oils, 7 per centum nd valorem. Grapevines, gooseberry, raspberry and currant bushes, 17 per centum ad valorem. Farm wagons nnd finished parts thereof, 22 per centum nd valorem. Plows, tooth and disk harrows, harvesters, reapers, agricultural drills and planters, mowers, horeo rnkes, cultivators, thrashing machines, Including wind stackers, baggers, weighers nnd self feeders therefor and finished parts thereof Imported for repair of tho foregoing. 15 per centum nd valorem. Portable engines with boilers In combination, horsepowers nnd traction engines for farm purposes, hoy loaders, potato diggers, fodder or feed cutters, grain crushers, fanning mills, hay tedders, farm or field rollers, manure spreaders, weedcrs nnd windmills nnd finished parts thereof Imported for repair of the foregoing, except shafting, 20 per centum ad valorem. Grindstones of sandstone, not mounted, finished or not, G cents per hundred pounds. Freestone, granite, sandstone, limestone end all other monumental or stone, except marble, breccia and onyx, unmanufactured or not dressed, hewn or polished, 12 per centum ad valorem. Rooting slates, 00 cents per hundred - THE- repro-sentatlv- col-lect- Oxldo of Iron as a color, 22 per centum ad valorem. Asbestos, further manufactured than ground; manufactures of asbestos ot articles of which asbestos Is the component material of chief value, including woven fabrics, wholly or in, chief valuo of asbestos, 22 per centum ad valorem. Printing Ink, 17 per centum ad valorem. Cutlery, plated or not pocketknlves, penknives, scissors nnd shears, knives and forks for household purposes nnd table steels 27 per centum ad valorem. Bells and gongs, brass corners and rules for printers, 27 per centum ad valorem. Basins, urinals and other plumbing fixtures for bathrooms and lavatories; bathtubs, sinks and laundry tubs of earthenware, stone, cement or clay or of other material, 32 per centum ad valorem. Brass band Instruments, 22V4 per centum ad valorem. Clocks, watches, time recorders, clock and watch keys, clock cases and clock movements, 27 per centum ad valorem. Printers wooden coses and cabinets for holding type, 27 per centum ad valorem. Wood flour, 22 per centum nd valorem. Canoes and small boats of wood, not power boats, 22 per centum ad valorem. Feathers, crude, not dressed, colored or otherwise manufactured, 12 per centum- ad valorem. Antiseptic surgical dressings, such as nbsorbent cotton, cotton wool, lint, lamb's wool, tow, Jute, gauzes and oakum, prepared for uso as surgical dressings, plain or medicated; surgical trusses, pessaries and suspensory bandages of all kinds, 17 per centum nd valorem. Plato glass, not beveled, in sheets or panes exceeding seven squnro feet each and not exceeding twenty-flv-c square feet each, 25 per centum - Motor vehicles, other than for railways and tramways and automobiles nnd parts thereof, not including rubber tires 30 per centum nd valorem. Iron or steel digesters for tho manufacture of wood pulp, 27 per centum nd valorem. Musical Instrument cases, fancy enscs or boxes, portfolios, satchels, reticules, cardcases, purses, pocket- books, fly books for artificial flies, all tho foregoing Composed wholly or In chief value of leather, 30 per centum nd valorem. Aluminium In crude form, C cents per pound. Aluminium In plates, sheets, bars nnd reds, 8 cents per pound. Laths, 10 cents per thousand pieces. Shingles, 30 cents per thousand. Sawed bourds, planks, deals nnd other lumber, pinned or finished on one side, 50 cents per thousand feet, board measure; planed or finished on one side nnd tongued nnd grooved, or pinned or finished on two sides. 75 cents per thousand feet, board measure; planed or finished on three sides, or planed and finished on two sides nnd tongued per thousand and grooved, $1.12 feet, board measure; planed nnd finished on four sides, $1.50 per thousand feet, board measure; and In estimating board measure under this Bchcdulo no deduction shall bo made on board measure on account of planing, tongulng nnd grooving. Iron ore, including mnnganifcrous Iron oro and tho dross or residuum from burnt pyrites, 10 cents per ton, provided that In levying nnd collecting duty on iron oro no deduction shall bo made from tho weight of tho ore on nccount of molsturo which may bo chemically or physically combined therewith. Coal slack or culm of all kinds, such as will pass through a half inch screen, 15 cents per ton. Provided that tho duties above enumerated shall tnko effect whenever tho president of the United States shall hnvo satisfactory evidence and shall make proclamation that on the articles hereinafter enumerated tho growth, product or manufacture of the United States or any of Its possessions (except tho Philippine Islands and tho islands of Guam and Tutulla), when Imported therefrom Into the Dominion of Canada, duties not In excess of the following arc Imposed, namely: Fresh meats beef, veal, mutton, lamb, pork and all other fresh or refrigerated meats excepting game 1 cents per pound. Bacon and hams, not in tins or Jars, IVi cents per pound. Meats of all kinds, dried, smoked, tailed, in brlno or prepared or preserved In any manner, not otherwise herein provided for, 1 cents per pound. Canned meats and canned poultry, iO per centum ad valorem. Extract of meat, fluid or not, 20 per centum ad valorem. Lard and compounds thereof, cotto-lon- o and cotton stearlno and animal stearlne, 1 cents per pound. Tallow, 40 cents per hundred pounds. Egg yolk, egg albumen and blood albumen, 7 per centum' nd valorem. Fish (except shellfish), by whatover same known, packed In oil, in tin boxes or cans, Including the weight of the package (a) when weighing oyer aqaare feet twenty ounces and not over thlrty-sl- x paving blocks, not Vitrified er ,4ecorted In any manner, maces each, 6 cents per package;, (b) over apd parte M?eks of stone, 17 per when weighingtwenty twelve ounces ounces eacb. 4. tad aot over eeatoB 4 valorem. lf ft -bw-Tiiorna-moated cents per package; (c) when weighing twelve ounces each or less, 2 cents per packago; (d) when weighing thirty-six' ounces each or more or when packed in oil, In bottles, Jars or kegs, 30 per centum ad valorem. Tomatoes and other vegetables, Including corn, In cans or other air tight packages and including the weight ofy tho package, IVi cents per pound. Wheat flour and semolina and rye flour, 50 cents per barrel of 100 pounds. Oatmeal and rolled oats, Including the weight of paper covering, 50 cents per hundred pounds. cents per hundred Cornmeal, 12 pounds. Barley malt, 45 cents per hundred pounds. Barley, pot, pearled or patent, one-hacent per pound. Buckwheat flour or mcnl, one-hal- f cent per pound. Split peas, dried, 7 cents per bushel of sixty pounds. Prepared cereal foods, not otherwise provided for herein, 17 per centum ad valorem. Bran, middlings and other offals of grain used for animal food, 12 cents per hundred pounds. Macaroni and vermicelli, 1 cent per pound. Biscuits, wafers and cakes when sweetened with sugar, honey, molasses or other material, 25 per centum nd valorem. Biscuits, wafers, cakes and other baked articles composed in whole or in part of eggs or any kind of flour or meal when combined with chocolate, nuts, fruits or confectionery, also candled peel, candled popcorn, candled nuts, candled fruits, sugar candy and per confectionery of all kinds, 32 centum ad valorem. Maple sugar and maple sirup, 1 cent per pound. Pickles, Including pickled nuts: sauces of alt kinds and fish paste or sauce, 32 per centum nd valorem. Cherry Juice and prune Juice, or prune wine, nnd other fruit Juices nnd fruit sirup, nonalcoholic, 17 per cent' um nd valorem. Mineral waters and Imitations of natural mineral waters in bottles or Jugs, 17 per centum ad vnlorem. Essential oils, 7 per centum nd valorem. Grapevines, gooseberry, raspberry and currant bushes, 17 per centum ad valorem. Farm wagons nnd finished parts thereof, 22 per centum nd valorem. Plows, tooth and disk hnrrows, harvesters, reapers, agricultural drills and planters, mowers, horse rnkes, cultivators; thrashing machines, including wind stackers, baggers, weighers nnd self feeders therefor and finished parts thereof imported for repair of tho foregoing, 15 per centum ad vnlorem. Portable engines with boilers, In combination, horsepower nnd traction engines, for farm purposes; hay loaders, potato diggers, fodder or feed cutters, grain crushers, fanning mills, hay tedders, farm or field rollers, manure spreaders, weeders nnd windmills nnd finished parts thereof Imported for repair of the foregoing, except shafting, 20 per centum nd valorem. Grindstones of sandstone, not mounted, finished or not, 5 cents per hundred pounds. Freestone, granite, sandstone, limestone nnd all other monumental or building stone, except mnrble, breccia or not and onyx, unmanufactured per dressed, hewn or polished, 12 centum nd valorem. Hoofing slates, 53 cents per hundred squnro feet. Vitrified paving blocks, not or decorated In nny manner, nnd paving blocks of stone, 17 pel centum nd vnlorem. per Oxldo of iron as a color. 22 centum nd valorem. Asbestos, further manufactured than ground; manufactures of asbestos or articles of which asbestos Is the component material of chief value. Including woven fabrics wholly or In chief value of nsbestos, 22 per centum nd " valorem. Printing ink, 17 per centum nd valorem. Cutlery, plated or not pocketknlves, penknives, scissors nnd shears, knives nnd forks for household purposes nnd tablo steels 27 per ceijtum nd valorem. Bells nnd gongs, brass corners and rules for printers, 27 per centum nd valorem. Basins, urinals and other plumbing fixtures for bathrooms nnd Invatorles, bathtubs, sinks nnd Inundry tubs of enrthenwnre, stone, cement or clay or of other material, 32 per centum nd valorem. per Brass band instruments, 22 centum ad valorem. Clocks, watches, time recorders, clock and watch keys, clock cases nnd clock movements,27per centum nd valorem. Printers' wooden cases and cnblncts for holding type. 27 per centum nd vnlorem. Wood flour, 22 per centum nd valf ornn-mente- ' lorem. Canoes and small boats of wood, not power boats,22per cenrumndvnlorem. Feathers, crude, not dressed, colored per or otherwise mnnufnetured, 12 centum ad valorem. Antiseptic surgical dressings, such as nbsorbent cotton, cotton wool, lint, lambs' wool, tow, Jute, gauzes nnd oakum, prepared for uso as surgical dressings, plain or medicated, surgical trusses, pessaries and suspensory bandages of all kinds, 17 per centum ad valorem. Plato glass, not beveled, In sheets or panes exceeding seven square feet each and not exceeding twenty-fiv- e square' feet each, 20 per centum ad valorem. Motor vehicles, other than for. railways and tramways, and automobiles and parts thereof, not Including rubber tires, 30 per centum ad valorem. " Iroa or steel digesters fer the man- - ufacture of wood pulp, 27 per centum ad valorem. Musical Instrument cases, fanoy cases or boxes, portfolios, satchels, reticules, cardcases, purses, pocket-bookfly books for artificial files, all the foregoing composed wholly or In Chief value of leather, 30 per centum nd valorem. Cement, Portland, and hydraulic or water lime in barrels, bags or casks, tho weight of the packago to bo included In tho weight for duty, 11 cents per hundred pounds. Trees apple, cherry, peach, pear, plum and quince, of all kinds, and small peach trees known ns June buds 2 cents eacb. Condensed milk, the weight of the package to be included In the weight for duty, 2 cents per pound. Biscuits without added sweetening, 20 per centum ad valorem. Fruits fn nlr tight cans or other nlr tight packages, the weight of tho enns or other packages to be Included in the weight for duty, 2 cents per pound. Peanuts, shelled, 1 cent per pound. cent per Peanuts, unshelled, one-hapound. Coal, bituminous, round and run of mine, including bituminous coal such r as will not pass through a inch screen, 45 cents per ton. Thnt tho articles mentioned In the following paragraphs, the growth, product or manufacture of tho Dominion of Canndu, when Imported therefrom Into tho United Stntes or any of its possessions (except the Philippine Islands and the islands of Guam and Tutulla), shall be exempt from duty namely: cattle, horses nnd Llvo nnlmnls mules, swine, sheep, lambs and nl! other live animals. Poultry, dead or alive. Wheat, rye, oats, barley and buckwheat, dried peas and beans, edible. Com, sweet com or maize. Hay, straw and cowpens. potatoes, sweel Fresh vegetables potatoes, yams, turnips, onions, cabbages and all other vegetables In thelt natural state. Fresh fmlts apples, pears, poaches, grapes, berries nnd all other edlbl fmlts In their natural state, except lemons, oranges, limes, grapefruit shaddocks, pomelos nnd plnnpples. Dried fmlts apples, peaches, pears and apricots, dried, desiccated or evaporated. Dairy products butter, checso and fresh milk nnd cream, provided that cans actually used In tho transportation of milk or cream may ho passed back nnd forth between the two countries free Of duty, under such reg ulntlons ns tho respective governments may prescribe. Eggs of barnyard fowl In the shell. Ilonoy. Cottonseed oil. Seeds flaxseed or Unseed, cotton seed nnd other oil seeds: grass seed. In-- ' . eluding timothy nnd clover seed; field nnd other seed not herein rherwlso provided for, when In pack-ngeweighing over one pound each (not Including flower seeds). Fish of nil kinds, fresh, frozen, packed in ice. salted or preserved In any form, except sardines nnd other fish preserved in oil, and shellfish of nil kinds, Including oysters, lobsters nnd clams in any state, fresh or packed, nnd coverings of the foregoing. Senl, herring, whnlo nnd other fish oil, including sod oil, provided thnt fish oil, whnlo oil, seal oil and fish of all kinds, being tho product of fisheries carried on by tho fishermen of the United States, shall bo admitted Into Canndn as tho product of tho United States, and slmllnrly thnt fish oil, whnle oil, seal oil and flsh of all kinds, lelng tho product of fisheries carried on by tho fishermen of Canada, shall be admitted into tho United Stntes ns tho product of Canndn. Salt. Mineral wnters, natural, not In bottles or Jugs. Timber, hewn, sided or squnred otherwise than by sawing, and round timber used for spars or In building whnrfs. Sawed boards, planks, deals and other lumber not further manufactured than snwed. Paving posts, railroad ties nnd telephone, trolley, electric light nnd telegraph poles of cedar or other wood1'. Wooden staves of nil kinds, not further mnnufnetured than listed or Jointed, nnd stavo bolts. Pickets and palings. Plnster rock or gypsum, crude, not ground. Mica, unmanufactured or rough trimmed only, nnd mica, rround or bolted. Fcldspnr, crude, powdered or ground. Asbestos, not further manufactured than ground. Fluorspar, crude, not ground. Glycerin, cmde, not purified. Talc, ground, bolted or precipitated, naturallyorartlflclally.not fortollet use. Sulphato of sodn, or salt cake, and soda nsh. Extracts of hemlock bark. Carbon electrodes. Brass In bars and rods, in coll or otherwise, not less than six feet In length, or brass In strips, sheets or plates, not polished, planished or coated. Cream separators of every description aud parts thereof Imported for repair of tho foregoing. Rolled iron or steel sheets or plates, No. 14 gauge or thinner, galvanized or :oated with zinc, tin or other metal or s, lf three-quartegar-'den- s Crucible cast steel wire valued nt not less than G cents per pound. ' Galvanized Iron or steel wire, curved or not, Nos. 0. 12 nnd 13 wire gauge. Typecasting and typesetting machines nnd parts thereof adapted for nee in, printing offices. Barbed fencing wire of lroa or steel, galvanized or not Coke. not. Rolled round wire rods in the coll, of of iron or steel, not over three-eightaa Inch In diameter and not smaller Ihau No. 8 wire gauge. Provided, That the articles nbovo enumerated, the growth, product or manufacture of tho Dominion of Can ado, shall be exempt from duty when the president of the United States shall have satisfactory evldenco and shall make proclamation that the following articles, tho growth, product or manufacture of tho United States or any of its possessions (except the Phillpplno Islands and the Islands of Guam and Tutulla), aro admitted Into the Dominion of Canada free of duty namely: YN my annual messago of Dec. 6, 1010, I stated that the policy of Live animals cattle, horses and broader and closer trade rela- mules, swine, sheep, lambs and all tlons with the Dominion of Can other live animals. Poultry, dead or alive. ada which was initiated in the adjustWheat, rye, oats, barley and buck- ment of tho maximum and minimum wheat dried peas and beans, edible. provisions of the tariff act of Aug. 5, Corn, sweet com or malzo (except 1009, had proved mutually beneficial Into Canada for distillation). nnd that it Justified further efforts for I Ilay, straw and cowpcas. tho readjustment of the commercial Fresh vegetables potatoes, sweet relations of tho two countries. potatoes, yams, turnips, onions, cabOn tho 7th of the present month two bages and all other vegetables In their cabinet ministers came to Washington natural state. l.ns representatives of the Dominion Fresh fruits apples, pears, peaches, government, nnd tho conferences were grapes, berries and all other ediblo continued between them and tho sec- retnry of state. The result of the nefmlts in their natural state. Dried fruits apples, peaches, pears gotiations was that on the 21st Inst a nnd apricots, dried, desiccated or evap- reciprocal trade ngreementwns reached. orated. One by one the controversies resultDairy products butter, cheese and ing from the uncertainties which atfresh milk nnd cream, provided that tended the partition of British terricans actually used In the transporta- tory on the American continent nt tho tion of milk or cream may be passed close of the Revolution nnd which wero back and forth between the two coun- inevitable under the then conditions tries free of duty, under such regula- have been eliminated, some by arbitrations as the respective governments tion and some by direct negotiation. may prescribe. The pnth having been thus opened Eggs of barnyard fowl In the scell. for the Improvement of commercial reHoney. lations, a reciprocal trade agreement is Cottonseed oil. the logical sequence of all that has Seeds flaxseed or Unseed, cotton- been accomplished In disposing of matgrass seed. ters of a diplomatic and controversial seed nnd other oil seeds; Including timothy and clover seed; gar- character. Tho identity of Interest of den, field and other seed not herein two peoples linked together by race, otherwise provided for when In pack- language, political Institutions nnd geoages weighing over one pound ench graphical proximity offers the founda(not Including flower seeds). tion. Fish of nil kinds, fresh, frozen, packThe guiding motive in seeking aded in Ice, salted or preserved In nny justment of trade relations between form, except sardines nnd other flsh two countries so sltunted geographicalpreserved In pl, npd shellfish of nil ly should bo- - to giro play to productive kinds, Including oysters, lobsters nnd forces as far as practicable, regardless clnms In nny state, fresh or packed, of political boundaries. While equivaand coverings of the foregoing. lency should be sought In nn nrrange-men- t Seal, herring, whale and other flsb of this character, an exact oil, including sod oil, provided that of financial gain Is neither lmper-ntlv- o oil, seal oil nnd flsh ol fish oil, whale nor nttnlnnble. No yardstick can nil kinds, being tbu product of fisher- measure tho benefits to the two peoies carried" on by the fishermen of the ples of this freer commercial Inter United States, shall be admitted lntc course, nnd no trade agreement should Canada ns the product of the United be Judged wholly by custom houso sta-- I Stntes, and slmllnrly thnt fish oil, tlstlcs. whale oil, seal oil and fish of nil kinds, Wo have reached n stage In our own being tho product of fisheries carried development thnt calls for a stntes-- i on by the fishermen of Canndu, shnll manlike and broad view of our future be admitted Into the United States ns economic status nnd Its requirements. the product of Canada. We have drawn upon our nntural reSalt. sources In such a way ns to Invite atMineral wnters, natural, not In bot- tention to their necessary limit. This, tles or Jugs. bus properly nroused effort to Timber, hewn, sided or squared oth- them, to avoid their wnste nnd t reerwise than by sawing, and round tim- strict their use to our necessities. Wo ber used for spars or In building have so Increased in population nnd In wharves. our consumption of food products nnd Snwed board-- planks, deals and oth the other necessities of life, hitherto er lumber, not further manufactured supplied largely from our own country, than sawed. that unless we materially Increase our Paving posts, railroad ties nnd tele- production wo can see before us n phone, trolley, electric light and tele- change In our economic position from graph poles of cedar or other woods. that of a country selling to the world Wooden staves of nil kinds, not fur- food and natural products of the farm ther manufactured than listed or joint- nnd forest to one consuming and imed, nnd stave bolts. porting them. rickets nnd palings. Ought we not, then, to nrrange n comnot Plaster rock or gypsum, crude, mercial agreement with Canada, If we ground. can, by which we shall have direct acMica, unmanufactured or rough trim- cess to her great supply iff natural med only, and mica, ground or bolted products without nn obstructing or powdered or ground. prohibitory tariff? This is not n vioFeldspar, crude, Asbestos, not further manufactured lation of the protective principle, ns than ground. that has been authoritatively anFluorspar, crude, not ground. nounced by those who uphold It, Glycerin, cmde. not purified. that principle does not call for Tnle, ground, bolted or precipitated, a tariff between this country nnd one naturallyorartlflclally.not fortollet use. whose conditions ns to production, Sulphate of soda or salt cake nud population nnd wnges aro so like ours soda nsh. and when our common boundary lino Extracts of hemlock bark. of 3,000 miles In Itself must mnko n Carbon electrodes. radical distinction between our comBrass In bnrs nnd rods, In coll or mercial treatment of Canada nnd of otherwise, not less than six feet In any other country. length, or brass In strips, sheets or The Dominion has greatly prosperplates, not polished, planished or conted. ed. It has an active, aggressive and Cream separators of every descrip- Intelligent people. They are coming tion and parts thereof Imported for to tho parting of the ways. They repair of tho foregoing. must soon decide whether tlivy nro to Boiled Iron or steel sheets or plates, regard themselves as Isolated perNo. 14 gauge or thinner, gnlvnnized or manently from our markets by a percoated with zinc, tin or other mctnl, petual wall or whether we are to be or not. commercial friends. If we give them Crucible cast steel wire, valued at reason to take the former view cnu we fl cents per pound. not less than complain If they adopt methods denyGalvanized Iron or steel wire, curved ing access to certain of their natural or not, Nos. 0. 12 nnd 13 wire gauge. resources except upon conditions quite Typecasting nnd tyjcsottIng ma- unfavorable to us? A notable Instance chines nnd parts thereof adapted for of such a possibility may be seen In use in printing offices. tho conditions surrounding the supply Barbed fencing wire of iron or steel, of pulp wood and the manufacture of gnlvanlzcd or not. print paper, for which wo have made Coke. n conditional provision In the agreeRolled round wire rods In the coll, of ment, believed to be equitable. s of iron or steel, not over The entire foreign trade of Canada nn Inch In diameter nnd not smaller In the Inst fiscal year, 1010, was than No. 0 wire gauge. TJio Imports were $370,000.-00nnd of this amount the United Section 2. Pulp of wood meehnn-lcall- y ground; pulp of wood, chemical, States contributed more thnn $223,000.-00The reduction In tho duties Imblcachcd'or unbleached; nows print paper nnd other paper nnd paper board posed by Canndn will lnrgely Increase manufactured from mechanical wood this amount nnd glvo us even n larger pulp or from chemical wood pulp or sharo of her market than wo now great as that is. of which such pulp Is the component Since becoming n nation Canada has material of chief vnlue, colored in tho pulp or not colored nnd valued at not been our good neighbor. Immediately more than 4 cents per pound, not In- contiguous across a wldo continent cluding printed or decorated wall pa- without nrtiflcial or nntural barrier navlgnblo waters used In comper, being the products of Canada, mon. when imported therefrom directly Into wny She has cost us nothing in the United States shall bo admitted of preparations for defense tho ngnlnst freo of duty on tho condition prece- her possible assault, and she never dent thnt no export duty, export will. She has sought to agree with fee or other export charge of us quickly when differences hnvo disnny kind whatsoever (whether in tho turbed our relations. Sho shnres with form of additional chargo or license us common traditions and aspirations. fee or otherwise), or any prohibition or I feel I havo correctly interpreted tho restriction; in nny way of tho exporta- wish of tho American people by extion (whether by law, order, regula- pressing In tho arrangement now subtion, contrnctunl relation or otherwise, mitted to congress for Its approval directly or indirectly), shall havo been their desire for u more intlmato and Imposed upon such paper, board or cordial relationship with Canada. I wood pulp or the wood used In tho therefore earnestly hope- that tho measmanufacture of such paper, board or ure will bo promptly enacted into law, wood pulp or the wood, pulp used In the WILLIAM n. TAFT. The White House. Jan. 20, ioij. manufacture of such paper or board. From President's Message On Canadian Reciprocity I Jl I I ! bal-nn- I , three-eighth- 0. 0, 0. if en-Jo- y, I A ex-te- pt - k r& i tmovHupm i'iii)iniBa iutirwwifiiWH(aaeataasua maiMiiinn myMiMi.m nm wiM' ij" ''' ' er '''JfW '' -- JTfo Hartord Herald ... man Bergo'r, Socialist of Wisconsin, to-da- y. 5sr A PLEA TO UNITARIANS WEDNESD AV M AY 3 power of IDE CHILDREN MEJPCIED In Our Our Boasted Coun- try VITAL Of Education. BROUGHT OUT FACTS At Session of Woman's Con- gress Matter Needing Attention. A SHOWN . i SHAMEFUL CONDITIONS April 2S. While Washington, American missionaries are working energetically in fields across the in seas, about 4,000,000 children the United States are being brought up without educational facilities of any sort, and the foreign countries to which the United States send misby supsionaries are reciprocating plying money to aid America's neglected boys and girls. These are some of the facts sessions of brought out at the Mothers' Congress. The day was devoted to problems concerning the welfare of the children. Miss Martha OIpIow made the Interesting statement that America was now doing more for children In the Philippines and Guam than for children tihv mountain districts of Its own territory. She added that foreign countries to which America had alwas sending missionaries ready sent donations "to help better the conditions of children in the mountain regions." (Miss Gielow declared that In some of the districts she had visited, children were compelled to walk seven nlles to school and said she had frequently seen hovels the doors of which were the hides of animals. Judge William H. DoLacy, of the Juvenile Court, told the congress tonight that if parents In the United States wore delinquent in their duties to their children, the State should compel the parents to perform those duties, and he added that if the neglect continued, it became the duty of the State to make suitable provision for the protection of the children. Judge DeLacy has made a long nnd exhaustive study of child welfare and was the first Judge of the District of Columbia Juvenile Court. "In our Declaration of Independence," he said, "wo hold It to be that all men were created equal and that they were endowed by tholr Creator with certain Inalienable rights the right to life, liberty and the pursuit of happiness and that to conserve these rights, governments were established. The Government has been formed to protect the rights of tho children as well as others, so that upon falluro of parents, from whatever cause, to accord their rights to the children, it becomes the duty of tho State to protect tho children, either by enforcing the parental duties or by making suitable provision for them If the parents will not." Among other features of the day was a series of stereoptlcon views shown by Logan W. Page, of the good roads department of tho Government. These pictures and their attendant descriptions were a part of tho propaganda for good roads in Isolated places to permit children to attend school. Mrs. Frank de Garmo.of St.Louls, said that In the South the people were being awakened to the necessity of good roads, and that in many districts moving pictures were being used to emphasize this need. She said that in many instances the women helped build the roads while the men hunted. 's self-evide- nt It Startled the i AVorld When tho astounding claims were Arnica first made for Bucklon's Salve, but forty years of wonderful cures have proved them true, and everywhere it is now known as tho best salve on earth for burns, scalds, sores, cuts, bruises, sprains, swellings, eczema, chapped hands, fever sores and piles. Only 25c at James m H. Williams. SOCIALIST MEMBER WANTS THE SENATE ABOLISHED Washington, April 27. A resolution demanding a constitutional amendment abolishing tho United States Senate, and giving all of Its duties to tho House, with referen- j , ,t ( I which may be Indum provision, voked upon petition of five per cent of the of the voters in three-fourtStages, as introduced by Congress- -, r further asks that the OTTERED BT PRESIDENT the Supreme Court in declaring laws unconstitutional,, be The resolution states curtailed. that the Senate has become an "ob- Urges "Principal Church" in Nastructive and useless body, and a tional Capital to Enlighten menace to the liberty of the people." Ber-gIn discussing the resolution, Country. declared the Senate had run Its course and must, at some time, as Washington, D. C, April 27. A th British House of the Lords has plea to all Unitarians to stand forth is loaded done, yield to popular demand. and aid the faith and to provide In Washington a "principal church" to MAGAN. of April 29. Mr. and Mrs. C. L. correspond with the cathodrals was made in other denominations Patton, of Adaburg; Mr. and Mrs. tho remarks by President Taft In It. A. Duke and little sons, J. A. and the regular service rn All Souls H. A., of Hartford; Mr. and Mrs. J. church, of which he Is a H. Miller, of near Dundee, and Miss Unitarian regular attendant. Artie Barnott spent Sunday with In his address made from the Mr. and Mrs. C. E. Miller. platform of the church, he referred Little Miss Kathleen Miller spent discussion of his religious last week with her grandparents, to tho In his Presidential campaign. had to be killed. faith Mr. and Mrs. J. H. Miller, of near The President said to some per Dundee. sons it may not seem a necessary WYSOX. of Mr. and Mrs. Rob Tanner, of May 1. The storm and hall did spent last week the guests task to have a church which should is to a great deal of damage in this com of Mr. 'and Sirs. S. H. Tanner nnd show forth what Unttarlanlsm country. munity last Saturday. The roof was Mr. and Mrs. J. W. Westerileld, of the "Anyone who has run for office," blown off Mr. Evan Davenport's this place. said he, "and has received telegrams house and the family were compell stood years. Mr. Otis Baughn is very sick. test for over parts of the country ed to go to their barn A part of the Mrs. Maude Stevens and son Wal- from various reported hero that you roof was blown off Mr. A. J. Daven lace went to Owensboro Friday saying, 'It is all others onco port's barn and his hay was dammorning, returning Saturday morn- are a Unitarian; telegraph at outrageous report, aged. Tho hall has badly damaged to silence this ing. measured. .will know the necessity for show- the gardens and fruit. Mr. Wilcox's Mr. J. W. Muffett went to Duning what Unltarlanlsm Is and that barn was blown down. Some people dee Saturday. progressive Christianity, illus- say that more rain fell than they Miss Sallio Grlfllth, of Sugar It is trating and carrying forward as the ever saw fall at one time before. Grove, spent last week with Mrs. supreme Ideal the fatherhood of Mr. Hannibal Taylor, of Kansas, Douglas Prior. to raise more corn. God and the brotherhood of man. who has been at Mr. Walter BenMessrs. Sam Baker, of Pellvllle, "Now, I believe this Is a time for nett's for some time, very 111 of and Chas. Baker, of Patesvllle, spent succeed us to open our pockets, and If we heart trouble, Is not much bettor. persistent effort. Monday night at C. E. Miller's. money In them, to as Little Harlan Taylor, son of Mr. Mrs. C. L. Patton, of Adaburg, haven't the a Allen Taylor, Is not getting along your soil, use was here shopping Tuesday after- sume some obligations ahead with view to making this monument to so well. He has had measles. noon. liberal religion a suitable ono In the Mrs. H. E. Hill and Mr. and Mrs. Fertilizer, cultivate well results Other A. J. Davenport went to Rochester capital of our nation. SMALLIIOUS. churches, by reason of their organi- Saturday to purchase a carpet for May 1. Mrs." Ella Ktmbley, zation have cathedrals the church Cool Springs church. was the guest of Mr. Wm. . Mr. Billy Hoops, of Cool Springs family a few days last seat of hierarchy. 'Wo havo no bishops, but we neighborhood, died Sunday morn week. of this have clergymen who, If we did have ing. Miss Altha Addlngton, place, and Mr. Elmer Mitchell, of bishops, would be worthy of filling Bevler, were married In Owensboro, such a place, and it Is entirely fit- LOSS AT RANGOR MAY REACH THREE MILLIONS ting, therefore, that we should have Saturday. April 2!th. Addlngton and chil- here In the capital of the nation n Mrs. Herman Bangor, Me., May 1. Between church that corresponds dren are visiting Mrs. Orvllle Balls, principal and three million to the cathedral In other churches." two and of Owensboro. dollars will cover the financial loss Mrs. Nucl Everly, Cleaton, Is visof the flro which destroyed approxiting her grandparents and other CASES IN THE FEDERAL COURT AT OWENSBOHO imately 285 residences and about here. relatives ono hundred business structures In Mrs. Lewis Fulkerson was the guest of Mrs. Ersklne Fulkerson at In th. Federal Court at Owens this city last night and early agencies estimate thoy He?. Insurance boro, Monday, Dan Tavlor Point Pleasant, Wednesday. Wing James, Centertown, Carter, Bert Carrier, John Gary, will lose about $1,500,000. Mr. So far only two aro known to be spent a few days the latter part of Jim Davles, Tom Cole, Nick Lewis, V4VVVVVVVVVVVVVVVVVVVVVVVVVVVVVtyVVVVVVVVVVVVVVVVVVVVVVl fami his son, Mr. Joe Dick Campbell and Zack White were dead and about seventy-fiv- e last week with each lined $100 nnd sentenced to lies destitute. Armod troops patrollJames, and family. under orders girl and called to the men above to has re- thirty days In jail for bootlegging, ed the streets Little Miss Nora James turned from a vIsIKto relatives In encli of the defndants entering a to shoot in case of palpable looting. O KENTUCKY NEWS NOTES. O pull. Added to her weight of 160 The city Is in darkness owing to the OOOOOOOOOOOOOOO pounds, was that of her drenched plea of guilty to the charge. Centertown. clothing, and It took three men to Mrs. Sam WIthrow went to HartWilliam Simmons, a little white burning of a branch power house. John G. Wilson, a section fore- pull tho two over the edge of tho ford Saturday, shopping. boy, who has been confined in the COCKLEBURR SPROUTS man, was killed by a train at Sloan's well. Moorman, jail for several weeks on a charge Miss Flora Busklll, KILL DROVE OF HOGS Valley. spent a tew days last week the guest of having robbed the United States William Watson shot and killed STATE COAL OPERATORS of Miss Blanche WIthrow and Mrs. mail soveral months ago, In HenRockport, Ind May 1. David ELECT THEIR OFFICFRS Bob Billings. derson county, was found guilty, Hill, a farmer, living north of his cousin, John Watson, In a brawl Mrs. Sara Greer returned Satur- and was sentenced to four years' Rockport, was much surprised at Williamsburg. to Ky., April 28. The Louisville, day from a visit to her daughter, confinement In the school of reform The Kentucky State Dental Assolind 16 of his finest hogs dead In a Western Kentucky Coal Operators' Mrs. S. W. Bllbro, Matanzas. N. Y. Ho was tho driver pasture. at Elmlra, Upon Investigation he ciation will hold Its annual conven- association, at a meeting held toMrs. Tom Miller Is quite sick. cf i mall wiViii. found the porkers had rooted in an tion In Owensboro May day at the Seelbach, elected officers Mrs. Alva Calloway and children In the case of the United States old cockleburr patch and eaten the The body of John Otis, sixteen for the ensuing year as follows: spent Tuesday with Mr. T. W. Ben- against H. S. and Annie L. McGin-nlssprouts. He was told the sprouts years old, who was drowned at Davis, of Kenseo and Louisville, family at Prontls. nett's Ida and E. O. Kuykendall, J. are deadly In their poison when eat- High Bridge, has been recovered. president; F. P. Wright, Bevler, B. Newton and tho Evansvllle and en In large quantities. special from Hickman says tho A TO HE GIVEN WATCHES vice president; D. Stewart Miller, Bowling Green Packet company, a cotton acreage in that section, on AS REWARD FOR KRAVERY side, Owensboro, secretary and commisverdict for the plaintiff was renderOne Hundred Years Old. the Tennessee and Missouri sioner. ed. The case ea ono in which tho' Last Monday, May 1, 1911, Union has been tripled'. Joseph S. Chandler and John H. Mr. Davis succeeds Capt. I. P. United States sought to condemn a county, Ky., was ono hundred years wero A blooded stallion and Jack Brlsby, both of Corydon, Ky., nre Barnard, of Louisville, who has servparcel of land for tho building of old. destroyed In a barn Are near Neweach to bo presented with a hand- locks and dam ed as president for twelve years. at a point in Butler On January 15, 1811, the act castle. Thoy were the property of some gold watch by E. G. Bogart, Both Mr. Wright and Mr. Miller Woodbury. coi nty, passed by tho Kentucky Legislature Gusta Clements, a farmer. for their heroism one night about were for tho eleventh toJim Sillier, indicted for bootleg- creating the county of Union was Twenty thousand pounds of three weeks ago, when three burg- ging, was allowed to executo bond time. approved, and under Its provisions bacco wero destroyed In a Are In Secretary Miller stated that no lars attempted to rob the Corydon In tho sum of $100, and was allowUnion severed Its Identity with Hen- Meade county. The blaze Is said to Deposit Bank. Mr. Brlsby, who was business wbb transacted other than ed to go till November 27. Roy derson and on tho 1st of tho follow- havo been started by Incendiaries. night watchman at the bank, show- Halo entered a plea of guilty the election of ofllcers. to a ing May became a sovereign county. Mrs. Marcus Hill committed suied fight when ho discovered tho robsimilar charge, but on executing City by shooting hercide at Calvert bers, but was bound and gagged. Mr. For Sale. bond In the sum of $100, was allowself through tho heart Worry Chandler, who is telephone operator White Plymouth Rocks. Good over loss of property Is said to have ed to go till November 27, at which at Corydon, aroused tho town and time Caka ltnav find! RvlrW loh the court will pass sentence layers. Bred from prize winners. been the cause. was among some others who gavo Stock and eggs for sale. on him. Claimants to tho Robb estate in chaso to tho burglars. MURRAY A. HUDSON, Tho following prosecutions were Pennsylvania met at Lexington and p McHenry, Ky. continued: Irvln Trolly, counter-feltin- 12m3-organized for a legal battle to proBiliousness nnd Constipation. Charles Davis, Walter KelThose Louisville Candidates. cure a share of the property said to For years I was troubled with Joan Russell,-Wil- l The Glasgow Times Bays: biliousness and constipation, which ly. George Pcl'pcfer, be worth $50,000,000. Tindall, Bob Ferguson, retailThe fleshless skeleton of a man Jas. P. Edwards, E. J. McDer-mo- tt made life miserable for me. My apand W. M, Smith aro three was found near Lebanon Junction. petite failed me. I lost my usual ing liquor without license; Bonnie Pepsin prepara- Marshall and Felix Hlghtower, vio- Louisville candidates for the Lieu- A Jug, halt filled with whiskey, was forco and vitality. Louisville Is found near it. There Is no clew as tenant Governorship. tions and cathartics only made mat- lating pension laws. Tho case of Dr. A. B. Balrd vs. evidently after the to the ldontlty of the man. ters worse. I do not know whore I Gov. Willson has signed the death and It would bo well for had I not Ohio county, In which many people should havo been Stomach and here are Interested, had not come the rest of the State to make a men- warrant for tho execution of Roger tried Chnmberlain's Warren, a convict, who murdered a Tho tablets relievo up at the hour of going to press yes- tal note as to why she wants It Liver Tablets. 111 feeling Unless the negro and then not let her have it. at 'onco, strengthen terday evening. the is adjudged Insane, ho will hang the digestive functions, purity the May 25 in the jail yard at Frankstomach, liver and blood, helping RUNAWAY HORSE STOPPED BY A SHOT fort. tho system to do Its work naturally. - GROWN AND BRIDGE WORK Mrs. Rosa Potts, Birmingham, NOVEL METHOD OF ' Richmond, Ky., April 28. There Ala. These tablets are for sale by SAVING A GIRL'S LIFE For the refined and dainty woman is m was a clatter of hoofs on Main all dealers. what she demands now. Americans street this afternoon. Pedestralns n Oriska, N. D.r April 28. To save aro Ought to Know Better. halted and gazed at on dentistry, and are Miss Mario Smith from dath, H. P. not The Bowling Green Messenger two young girls In a buggy who satisfied with anything? but the Olson, of this, town, waB lowered says: "A goat lives about ten years, wero making frantic efforts to con McCAIX PATTERNS acme of perfection in dental work. Celebrated for atyle, perfect fit, lrapllcity nd head downward Into a well 22 feet and will give about a quart of milk trol a horse which had the bit bereliability nearly 40 yer. &oia in nearly Teeth extracted with as little pain only 18 Inches in diamea day." Ed Leigh ought to know tween Its teeth and was tearing every ciiyana town in win unucu auici na deep, and Canada, or by null direct. More aold than ter. Tho strain was so great that as possible, Children given careful that this depends entirely on the down the thoroughfare at top spepvd. any other make. Send lor free catalogue, the blood burst through his chest attention. Special attention to plate name. If it Is Nannie, .the goat will In his mad career th animal mado MeCALlS MAGAZINE More aubscribera thin any other fathton and his left arm. The girl was work and ALL WORK GUARANcome across all right. If It is Will-la- several sharp turns to escape other matatlne million a month. Invaluable, latest atylet, pattern!, ilrcaimaklne, millinery, barely alive. It would be best not to wait for vehicles and as it did so, the girls TEED. Work done at lowest prices. plain aewlng;, fancy needlework, halrdrctalng-Miss Smith fell Into the well and etiquette, (rood atorlea, etc Only 60 centa a that quart of milk. Such ignoranco were Jostled from side to side and year (worth double), including ,n free cattern. Olson tied a rope around his ankles In Imminent danger of being dashis disgusting and deplorable! Subicrjbo tjJjy, cr .ui for laiunlu copy. and crawled into the well while by4 Glasgow Times. ed to the street. WONlrERFUX. INDUCEMENTS Offl to Aetata. 1'uaUl bring;! premium catalogs li RifrtikM WMlug, tempts were When he standers held the rope. Several ineffectual and new ciihjulie offer. Addrett Subscribe for The Herald. $1 a year. made to halt the horse, but it cea- - m M4CUI ce ax t m w, rn k. mw vm reached the bottom he seized the Borgor tlnued on its way and people on the street oxpocted ovory minute to see tho buggy hurled the occupants-o- f to their death. The shouts of the crowd attracted the attention of former Mayor C. E. Woods, who rushif Into his home and secured a rifle, and as he fired. the runaway approached, Tho ball entered the. animal's right forefoot and it stumbled and fell. The sudden stop overturned the buggy nnd 'the girls were thrown to the ground, but escaped with miner injuries. The girls were Misses Isslo and Ilay Million, daughters of former Judge Million, and although very much frightened, thoy attempted to make light of the danger from which they had escaped. They explained that the horse which they had driven many times had be come frightened at the breaking of a piece of the harness. Tho animal pT- - f t. M1-- ? "n. V A4y4WIr1 iltl;, f ' . 'M r ."' , FERTILIZERS ARE ON THE MOVE Our Warehouse with w '" x. Ji" ,M 1 Challenge Corn Grower PURE GROUND BONE, Homestead Tobacco Grower. These Famous Grades the HORSESHOE BRANDS the Have 30 They are the standard by which are We need We can't without prepare Properly pure Animal Matter and watch' Be-vie- r, 1. We can load your wagon any day, and your load will make you money. one-ha- lf to-da- y. E. P. Barnes & Bro., Beaver Dam, Kentucky. ht 600000000000000 (I 23-2- 5. s, Hy-w- ell ' ni RHmKlDNEYCUrc g; f'fpa te Lieutenant-Governorshi- p, to-d- fellow-prisone- r. WELL-AIME- D horror-stricke- M , DR. H. J. BELL, HARTFOED, KY.